KEGG   Bacillus sp. JS: MY9_0340Help
Entry
MY9_0340          CDS       T02027                                 

Definition
(GenBank) assimilatory nitrite reductase subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00910  Nitrogen metabolism
bjs01100  Metabolic pathways
bjs01120  Microbial metabolism in diverse environments
Module
bjs_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MY9_0340
Enzymes [BR:bjs01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     MY9_0340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD NIR_SIR Pyr_redox Rubredoxin_C NIR_SIR_ferr Pyr_redox_3 HI0933_like AlaDh_PNT_C GIDA NAD_binding_7 3HCDH_N Trp_halogenase Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: AFI26879
UniProt: I0F073
LinkDB All DBs
Position
complement(350055..352472)
Genome map
AA seq 805 aa AA seqDB search
MGKKQLVLVGNGMAGVRAIEEILSVAKDEFQITIFGAEPHPNYNRILLSKVLQGDTDIKD
ITLNDWDWYEENNIQLYTNETVIKVDTENKTVITDSDRIQPYDELILATGSVPFILPIPG
ADKKGVTAFRDIKDTDTMLAASKQYKKAAVIGGGLLGLEAARGLLNLGMEVSVIHLAPFL
MERQLDATAGRLLQNELEKQGMTFLLEKQTEEIVGDDRVEGLRFKDGTSIEADLVVMAVG
IRPNTTLGAESGIPVNRGIIVNDYMQTEIPHIYAVGECAEHRGIAYGLVAPLYEQAKVLA
KHICGIDTKPYEGSVLSTQLKVSGVEVFSAGDFNESEEKKAIKVFDEQDGIYKKIVLRGN
QIVGAVLFGDSSEGNRLFSMIQKEADISETSKISILQPLDQEAGTSITAAMSDDEIICGC
NGVSKGAIIQAIQEKGCSSTDEIKACTGASRSCGGCKPLVEEILQHTLGSDFDASAQKEA
ICSCTTLSRDEVVEEIKAKGLSHTREVMNVLGWKTPEGCSKCRPALNYYLGMINPTKYED
ERTSRFVNERMHANIQKDGTYSVVPRMYGGVTNSTDLRKIADVVDKYEIPLVKMTGGQRI
DLIGVKKEDLPKVWEDLDMPSGYAYGKTLRTVKTCVGEQFCRFGTQDSMALGIALEKKFE
GLHTPHKVKMAVSACPRNCAESGIKDLGVVGIDGGWELYVGGNGGTHLRAGDLLMKVKTN
EEVLEYAGAYLQYYRETANYLERTSAWLERVGLSHVQSVLNDPKKRQELNDRMNETLSVH
KDPWKDFLEDKQTSKELFENVVTTS
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaaacagctagttcttgttggtaatggaatggccggggtaagggccattgaa
gagatactgagtgttgctaaagacgagtttcagatcacaatttttggtgccgaaccgcat
cccaactataatcgaatccttttgtcaaaagtgcttcaaggcgatacagatattaaagat
attacgttaaacgattgggactggtacgaagaaaacaacattcaattgtatacaaatgaa
acggtcatcaaagtagatacagaaaacaaaacagtcatcacagactcagacagaatccag
ccttacgacgaattaatcctggcgacaggctctgtcccttttatccttccgattccggga
gcagacaaaaaaggcgtcacagctttccgggatataaaagatacagacacaatgctcgcc
gcgtcaaaacaatataaaaaagcagccgtcatcggcggaggacttcttggtttggaagcc
gctcgcggactgctgaatctcggcatggaagtatccgtcatccacctcgccccattcctg
atggagcgccagcttgatgcaacggcaggacgcctgctgcaaaacgagttagaaaaacaa
gggatgacctttttacttgaaaagcaaaccgaagaaattgttggtgacgatcgtgtcgaa
ggcctccgtttcaaggatggcacaagcattgaagctgatttggtcgtcatggctgtcggc
atccgcccaaatacaacgctcggcgccgagagcggcattccggttaaccgcggtatcatc
gtcaacgattatatgcagacggaaatcccgcacatttacgcggttggcgaatgtgctgag
caccgcggaatcgcctacgggcttgtggcgccgctctatgaacaagcaaaagtgctggcg
aagcatatttgcggcatcgacacaaaaccgtatgaaggttctgttctctctacacagtta
aaggtatcaggcgtcgaagtcttctctgccggtgactttaacgaatcagaggagaaaaaa
gcgattaaagtctttgatgagcaggacggcatctataaaaaaatcgtcctgagaggcaac
caaattgtcggtgctgttttattcggcgacagcagcgagggcaaccgcctgttttctatg
attcaaaaagaagccgatatctctgaaacctcaaaaatatcaatcttacagcctctcgac
caagaagcaggcacaagcattaccgcagcgatgagcgacgatgaaatcatctgcggctgc
aacggcgtgtcaaaaggtgcgattattcaagccatacaggaaaagggctgctcgtcaacg
gacgagatcaaagcatgcaccggtgcatcccgttcatgcggaggctgtaagccgctcgta
gaagaaatcctccagcatacgctcggatcagactttgatgcgtcagcgcaaaaagaagcc
atttgcagctgcaccacattgtcgagagatgaggtcgtagaagaaatcaaagccaaaggg
ctgtcacatacaagagaagtcatgaatgtgctcggctggaaaacgccagaaggctgttcc
aaatgccgtccggctctgaactactacttaggcatgatcaatccaaccaaatacgaggat
gaacggacatcccgctttgttaatgaacgaatgcacgccaatattcaaaaagacggaaca
tactcagtcgttcctcggatgtacggcggcgtgaccaactctacagatttgcgcaaaatc
gctgatgtcgtcgacaaatatgagatcccgctcgtgaaaatgacaggcggacagcgaatt
gatcttatcggtgtgaaaaaagaagaccttccgaaggtatgggaagatcttgatatgcca
tcaggctacgcgtacggaaagacacttcggacagtcaaaacatgcgtaggcgagcaattc
tgccgcttcggcacacaagactccatggcactgggcattgcacttgagaaaaaattcgaa
gggctgcacacgcctcataaagtcaaaatggccgtgtctgcctgcccgcgaaactgtgcg
gaatccggcattaaggaccttggcgtagtcggcatcgacggaggctgggagctttatgtc
ggcggaaacggcggaacccatttgcgtgccggcgatttgctgatgaaggtaaaaacaaat
gaagaagtgttagaatacgcaggcgcttacctgcaatattaccgggaaactgcaaactat
ctggagcgtacatccgcatggcttgagcgcgtcggtttatcccatgtccagtccgtgtta
aacgatcctaaaaagcgacaggagctgaacgacagaatgaatgaaacactctctgtccac
aaggatccgtggaaagactttttagaggataaacaaacttctaaagaattatttgaaaat
gtcgtcaccacatcataa

DBGET integrated database retrieval system