KEGG   Bacillus sp. JS: MY9_0341Help
Entry
MY9_0341          CDS       T02027                                 

Definition
(GenBank) NasC
  KO
K00372  assimilatory nitrate reductase catalytic subunit [EC:1.7.99.-]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00910  Nitrogen metabolism
bjs01100  Metabolic pathways
bjs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MY9_0341
Enzymes [BR:bjs01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     MY9_0341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4
Motif
Other DBs
NCBI-ProteinID: AFI26880
UniProt: I0F074
LinkDB All DBs
Position
complement(352593..354635)
Genome map
AA seq 680 aa AA seqDB search
MQCKMQLVEQTIVTRKKYTAIGIDNPTTKGRLCMKGMNAHQHALNSSRITHPLLKKNGEF
MPVSWEEALNYIKEQVTTIQTEHGHDAMAVYGSASITNEEAYLLGKFARVGLQTKYIDYN
GRLCMSAAATAANQTFGADRGLTNPLSDIPHTRVIILAGTNIAECQPTMMPYFEKAKENG
AYIIAIDPRETATTKIADLHLKIKPGTDAALANGLVKIIIDEQLINEDFIQSRTNGFKEL
KQHTDSLNLNNIAEQTSVPLAHIRKAAVKFAKETSGMLFTARGIEQQTDGTAAVKGFLNM
VLITGKIGKPYSGYGAITGQGNGQGAREHGQKADQLPGYRSIENEQHRAHIAKVWGIHQD
DLPRKGVSAYEMMEKIHDGDIKGLFLTCSNPAVSSPNANLVKKALRKLTFFVAIDLFISE
TAEYADVILPASSYLEDEGTMTNVEGRVTLREASRPCPGEAKHDWQIICDLASVLGKGRY
FSYTSAEDIFNELREASRGGIADYSGITYERLRREGGIHWPCPEPDHPGTGRLFTESFAH
PDQKAALSVIPNEPPVPKEKPTADYPLYLTTGRVMSHYLTGVQTRKSAALAARHFESFME
IHPQTAATYNIEDRVLVKIESPRGSITVRSKLSEQIRKDTVFVPIHWADAQNVNDLIGEA
LDPACKMPGFKVCAVRIRPI
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcaaaatgcagctcgtggaacaaaccatcgtcacacggaaaaagtacacagcg
attgggattgacaatcctacgacaaagggccgtctctgcatgaagggcatgaatgctcac
cagcatgcgttgaactcctctcgcatcacccacccgctgctaaaaaaaaacggcgagttt
atgcctgtttcttgggaagaagcactgaattacatcaaagaacaagtgacaacgatccaa
acagaacacggccatgacgccatggctgtatacggaagcgcctcgataacaaatgaagag
gcgtatttgttggggaaattcgcacgagtgggcttacagaccaaatacattgactacaac
gggcggctttgtatgtccgccgccgcaaccgcagccaaccaaacattcggcgcggacaga
ggcctaacgaatcccttatcagacattccccacacccgtgtgatcattctggccggcacc
aatattgcggaatgccagcctacaatgatgccgtattttgaaaaagcgaaagaaaacgga
gcttacatcattgccattgatccgcgtgaaacagcgacaacaaaaatcgccgatcttcat
ctgaaaataaaacccggcacagacgccgcccttgccaacggtctcgtcaaaatcatcatt
gacgagcagctcataaacgaggatttcattcaatcacgaacaaatggattcaaggagctg
aagcagcatactgactcgttgaacctgaataacatcgctgaacagacgagtgtcccgctg
gcgcatataagaaaagctgctgtaaagtttgcaaaggaaacgtccggcatgctgtttaca
gcccgcgggattgaacagcaaaccgatggaacagcggctgtgaaaggcttcttaaacatg
gtgctgatcacaggaaaaatcggcaagccttactcaggttacggagcgatcaccggacaa
ggcaacgggcaaggtgcaagagagcatggccagaaagccgatcagcttccgggctaccga
tctatcgaaaatgagcaacaccgggcacatattgcgaaagtgtggggaattcatcaggat
gatctgccgcgaaaaggtgtctcagcctatgaaatgatggaaaaaatccatgacggcgac
attaaaggactgttcctcacgtgctccaatcctgctgtctccagcccaaatgcgaatctc
gtgaaaaaagccctaagaaaactaacattctttgtcgcaatcgatttgtttatttcagag
actgcggaatacgcagatgtgattttgccagcctcctcttatttagaagatgagggcacc
atgacaaatgtagaaggacgcgtgacattaagagaagcaagccggccatgtcccggcgaa
gcaaagcatgattggcagatcatttgtgatctcgcatccgttctcggcaaaggccgctac
ttttcttacacgtcagcggaggatatttttaatgaattaagagaagcgagccgaggaggg
atcgccgattattcaggcatcacatatgagaggctaagacgtgaaggcggcattcactgg
ccatgtccggaacctgatcatcccggaaccgggcgcttgtttacagaatcatttgctcat
ccggatcaaaaagcggcattaagtgtaattccaaatgaaccgcctgtgccaaaagagaag
ccgacagccgattatccgctttatttaacgacaggccgcgtcatgtctcactacttaaca
ggcgttcaaacaagaaaaagcgccgccctggccgcgagacattttgaatcgtttatggaa
atccatccgcaaacagcagcgacctacaatatcgaggaccgtgtactggtaaaaatagaa
tctccgcggggaagcatcaccgtccgcagcaaattatcagaacaaatcagaaaggatacc
gtttttgttcccattcattgggcagacgctcaaaatgtgaatgatttaatcggggaggcc
ttagatccagcctgtaaaatgcccggttttaaggtatgcgccgtccgaatcagacctatt
taa

DBGET integrated database retrieval system