KEGG   Bacillus sp. JS: MY9_0344Help
Entry
MY9_0344          CDS       T02027                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K09007  GTP cyclohydrolase IB [EC:3.5.4.16]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00790  Folate biosynthesis
bjs01100  Metabolic pathways
Module
bjs_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MY9_0344
Enzymes [BR:bjs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MY9_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCHY-1
Motif
Other DBs
NCBI-ProteinID: AFI26883
UniProt: I0F077
LinkDB All DBs
Position
358552..359466
Genome map
AA seq 304 aa AA seqDB search
MNQHMLLPKKTERLQYFGSVSPAKGEKPVEKEKMKDLQNIRKDYFFDIQHVGVANVSHPV
TITSAMAPAEQTTAANFIMTCDLPRNQKGINMSRLTELLQVYHQNGWILSFSSLQQFTKE
LAENMDASSASVEVRFPWFFERESPKLEKAGLMHADIFMSVTYREDQPFKQRAGISAKVT
TLCPCSKEISEYSAHNQRGTVNIWTDIHPAASLPSDVKADLLHVAESNASARLHPVLKRP
DEKAVTETAYENPRFVEDLARLIAADLFELEWVSAFEIECRNEESIHLHDAYAKLCFSKE
VDRI
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacacatgctgctcccgaaaaaaacggagcgtcttcaatactttgggtcggtc
agtccggccaagggtgagaaaccagtggaaaaagagaaaatgaaggacctgcaaaatatc
aggaaggattatttttttgacattcagcatgtaggtgtcgcgaatgtgtcccatccagtc
acaatcacttctgccatggcgcctgccgagcaaacaacggccgcgaactttattatgact
tgtgatttgccgagaaatcaaaaggggataaacatgagccggttaacagagctgctccaa
gtctatcatcaaaacggctggattctctcattttcctcccttcagcaatttacgaaagag
cttgcagaaaacatggacgcatcctctgcttcagttgaagtgaggtttccatggtttttc
gaacgagaaagtccgaagcttgagaaagcaggtctgatgcatgctgacatattcatgtct
gttacgtatcgtgaagatcagccgtttaaacagcgtgccggcatctcagctaaagtaacg
actctgtgcccttgttccaaggaaattagtgaatacagtgcccataatcagcggggaacg
gtcaatatttggactgatattcacccggctgcatcgctgccaagtgatgttaaagctgat
ttgcttcacgtcgcagaatcaaatgcctctgcgagactgcatccggtattgaagcgccct
gatgaaaaagcggtgacggaaacggcctatgagaatccgaggtttgttgaggatctcgcc
cggctgattgctgcggatttgtttgagcttgaatgggtgtcagcctttgagattgaatgc
cggaatgaagaatcaatccatctccacgatgcctatgcgaagctgtgtttttcaaaggaa
gtggatagaatatga

DBGET integrated database retrieval system