KEGG   Bacillus sp. JS: MY9_0350Help
Entry
MY9_0350          CDS       T02027                                 

Definition
(GenBank) Bacterial extracellular solute-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
bjs  Bacillus sp. JS
Pathway
bjs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MY9_0350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bjs02000]
    MY9_0350
   02035 Bacterial motility proteins [BR:bjs02035]
    MY9_0350
Transporters [BR:bjs02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    MY9_0350
Bacterial motility proteins [BR:bjs02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    MY9_0350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 Phosphonate-bd DUF3692
Motif
Other DBs
NCBI-ProteinID: AFI26889
UniProt: I0F083
LinkDB All DBs
Position
complement(362295..363158)
Genome map
AA seq 287 aa AA seqDB search
MKSFKQSKAVIFSFTMAFFLILAACSGKNEADSKDTGWEQIKDKGKIVVATSGTLYPTSY
HDTDSGSDKLTGYEVEVVREAAKRLGLKVEFKEMGIDGMLTAVNSGQVDAAANDIDVTKD
REKKFAFSTPYKYSYGTAIVRKDDLSGIKTLKDLKGKKAAGAATTVYMDVARKYGAKEVI
YDNATNEQYLKDVANGRTDVILNDYYLQTLALAAFPDLNIMIHPDIKYMPNKQALVMKKS
NAALQKKMNETLKEMSKDGTLTKLSKQFFNKADVSKKLNVDVQDVDL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatcattcaagcaatccaaagccgttatattcagtttcacaatggctttctttctt
atattggcagcctgttccggcaaaaatgaagccgattccaaggatacaggctgggagcag
attaaggataaagggaaaatcgtagtcgctacatcaggtacgctctatcctacttcttat
cacgataccgactctggctccgataagctgacgggctacgaggttgaagtcgttcgcgaa
gctgcaaaacgattggggctgaaggttgagttcaaggagatgggtattgacgggatgctg
acagcggtgaacagcggacaggttgacgcagccgcgaatgacatcgatgtgacgaaggac
cgcgagaagaagttcgcattttctactccatataaatattcatacggcacggcaatcgtc
cgtaaagacgatttatcagggattaaaacgcttaaggatttgaaagggaagaaagcggct
ggcgctgctaccaccgtctacatggatgtcgcgagaaaatacggcgccaaagaagtgatt
tatgataatgcgacgaatgagcaatatttaaaagatgtcgccaacggacgcactgatgtc
attttaaacgactattacctgcagacactcgcgctcgcagcattcccggatctcaacatt
atgatccatcctgacatcaagtacatgccgaacaaacaggcgcttgtcatgaaaaaaagc
aatgcggcacttcagaaaaagatgaatgaaacattgaaggaaatgagcaaggatggcact
ttgactaagctgtcgaagcaattcttcaataaagcagatgtatcaaagaaactgaatgtc
gacgttcaggacgttgatttgtaa

DBGET integrated database retrieval system