KEGG   Bacillus sp. JS: MY9_0382Help
Entry
MY9_0382          CDS       T02027                                 

Definition
(GenBank) hydrolase
  KO
K01259  proline iminopeptidase [EC:3.4.11.5]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00330  Arginine and proline metabolism
bjs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    MY9_0382
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bjs01002]
    MY9_0382
Enzymes [BR:bjs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.5  prolyl aminopeptidase
     MY9_0382
Peptidases [BR:bjs01002]
 Serine Peptidases
  Family S33
   MY9_0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Ndr LIDHydrolase
Motif
Other DBs
NCBI-ProteinID: AFI26921
UniProt: I0F0B5
LinkDB All DBs
Position
410981..411826
Genome map
AA seq 281 aa AA seqDB search
MERAGICHSDGFDLAYRIEGEGAPILVIGSAVYYPRLFSSDIKQKYQWIFVDHRGFAKPK
RELREEDSRLDAVLADIERMRTFLQLEDVIILGHSGHAFMALEYARTYPEHVQKVALFNT
APDNSEERQRKSESFFMETASLERKKRFEKDIANLPQDIENDPERRFVHMCIRAEAKSFY
QERPHAAALWDGVFTNMPIMDELWGNTFARLNLIQRLADVQVPVYIGLGRYDYLVAPVAL
WDTVDDLYPHVEKVIFEKSGHQPMLEEPQAFEQSFRKWLDQ
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtgcggggatctgtcactcggacggctttgatttagcttatcgaattgagggc
gagggcgcacccatccttgtgatcgggagtgcggtttactacccgcgccttttttcctca
gacatcaaacagaaatatcaatggatctttgtcgaccataggggatttgctaagcctaaa
cgagagcttcgtgaggaggattcgaggcttgatgccgttttggctgatattgaaaggatg
agaacatttcttcagcttgaggatgttatcatcctgggacattccgggcacgcttttatg
gctttagaatatgccaggacatatcctgaacatgtccagaaggtggcgctcttcaatact
gcgcctgataacagtgaagaaagacaacgaaaaagtgaatcattttttatggaaacagcc
agtcttgagagaaagaaacgctttgaaaaagatatcgcgaatttgccgcaggacattgaa
aacgatcctgaaagacgcttcgtacacatgtgtattcgcgctgaagcgaaaagcttttat
caagagcggccgcatgcagctgctttatgggatggcgtatttacgaatatgccgatcatg
gatgaattatgggggaatacatttgcccggctgaatctcattcagcggttagctgatgta
caagtgccggtgtacatcggcttaggaagatatgattatttggttgcgcctgttgcgcta
tgggatactgttgacgatttatatccacatgtggagaaggttatttttgaaaagagcggc
catcagccgatgctggaagaaccgcaagccttcgaacaaagcttcaggaaatggcttgat
caataa

DBGET integrated database retrieval system