KEGG   Bacillus sp. JS: MY9_0400Help
Entry
MY9_0400          CDS       T02027                                 

Definition
(GenBank) hypothetical protein
Organism
bjs  Bacillus sp. JS
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2
Motif
Other DBs
NCBI-ProteinID: AFI26939
UniProt: I0F0D3
LinkDB All DBs
Position
complement(431496..432914)
Genome map
AA seq 472 aa AA seqDB search
MDTSIEPKPFNRSVIVGILLAGAFVAILNQTLLITALPHIMRDFNVDANQAQWLTTSFML
TNGILIPITAFLIEKFTSRTLLITAMSIFTAGTIVGAFAPNFPVLLTARIIQAAGAGIMM
PLMQTVFLTIFPIEKRGQAMGMVGLVISFAPAIGPTLSGWAVEAFSWRSLFYIILPFAVI
DLILASILMKNVTTLRKTQIDILSVILSTFGFGGLLYGFSSVGSYGWSSSTVLISLLVGV
IALLLFITRQMKLEKPMLEFRVFTFGVFSLTTLLGTLVFALLIGTETILPLYTQNVRDVT
AFDTGLMLLPGAVVMGFMSPIIGRVFDRVGGRGLAIAGFCIIFLTSLPFMQLTDHTSLAW
IVVLYTVRLLGTAMIMMPVTTAGINALPRHLIPHGTAMNNTIRQVGGSIGTALLVSVMSN
QAAHAGTTNVKHAALHGMNAAFIVAAVIALVGFLLSFTLKKPQRPAEQQPAR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttggacacaagtattgaaccgaaaccttttaaccgttctgtcattgtcggcattttgcta
gccggagcgtttgtggcgattttgaatcagacattgttgattaccgccctcccccatatc
atgagggatttcaatgttgatgccaaccaagcacagtggctgaccacgtcatttatgtta
accaacgggatcttaattccgatcactgcgtttttaattgagaaattcacaagccggacg
ctgctcatcacagcaatgagcattttcaccgccggaacgattgtcggagcattcgcgccg
aacttcccggttctgctgacggctcgtatcattcaagcggccggagccggcattatgatg
ccgctcatgcagactgtattcctgacaatctttccgattgaaaagcgcggccaggctatg
ggtatggttggattggtcatctcatttgcgcctgcgatcggaccgactctttccggatgg
gctgtcgaagctttctcttggagatcattgttttatattattcttccgtttgctgtgatt
gatttgattcttgccagcatcctgatgaaaaacgtgacgactttaagaaaaacacagatt
gatattttatcagtcatcctttcaacatttgggttcggcggccttctgtacggcttctca
agcgtcggctcttacggctggtccagttcaaccgtcttgatttcactgctggtgggtgtc
atcgcgctgctcttatttatcacaagacaaatgaagcttgaaaaaccgatgctggaattc
cgcgtcttcacgtttggcgttttcagcttaacaacactgctgggaacccttgtctttgca
ttattgatcggtacggaaaccatcctgccgctttatacacaaaacgtcagagacgtcaca
gcttttgatacagggcttatgcttctgccgggagccgttgtgatgggcttcatgtcgccg
attatcggcagagtttttgaccgtgtcggcggaagagggctggcgattgccggtttctgc
atcatcttcctgacatcactgccgtttatgcagctgactgatcatacgtcactcgcttgg
attgtcgttttatacaccgttcgtctcttaggcaccgccatgatcatgatgccggtgaca
acagccggcatcaatgcgctgccgcgccacctgattccgcacggaacggcgatgaacaac
acgattcgccaagtcggcggctcgatcggaaccgcgctattggtttccgtgatgagcaac
caggcggcacatgcaggcacgacaaatgtaaagcacgccgccctgcacggcatgaacgcc
gcttttattgtggctgccgtcatagcacttgtcggcttccttctctcattcacactaaag
aaacctcagcgccctgccgaacagcagccggcacgctga

DBGET integrated database retrieval system