KEGG   Bacillus sp. JS: MY9_0449Help
Entry
MY9_0449          CDS       T02027                                 

Definition
(GenBank) YdaM
Organism
bjs  Bacillus sp. JS
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_2 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-ProteinID: AFI26988
UniProt: I0F0I2
LinkDB All DBs
Position
478035..479297
Genome map
AA seq 420 aa AA seqDB search
MGNTLFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRENMKELPKVSVLIPAHNE
EVVIRQTLKAMVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEKYDFIKMVITKPPNAGK
GKSSALNSGFAESNGDVICVYDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKT
LLTRFINIETICFQWMAQGGRWKWFKIATIPGTNFAIRRSIIEKLGGWDDKALAEDTELT
IRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGNQYVVLKFLAQFFKLKRKRII
FDLFYFFFTYFLFFFGVIMSNAIFVVNLFYDLHLSVGFLAMILWILAFFLFMTEVMITLS
IEKTEMNRQNFFIVFLMYFTYSQAWIVLVIYSLFIEIKHRLFKQEVKWYKTERYNQHKSG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
ttgggtaatacgctgttctttatctcgctaagtttaatatgggtgatgcttctctaccac
atgttcctcatgcagggcgggttccgccactatatgaccttcgaacggaatatcccgaag
tggagagaaaacatgaaggagctgccaaaggtcagcgtcctcatcccggcgcataacgaa
gaggttgtgattcggcagacgctgaaggcgatggttaacctttattatccgaaggaccgt
ctggagattatcgtcgtgaatgacaattcgtcagaccggacgggtgatatcgtcaatgaa
ttttccgagaaatacgatttcatcaaaatggtgattacgaagccgccgaacgcaggtaaa
ggaaaatcctctgcacttaactcgggttttgccgaatcgaatggcgatgtgatctgtgta
tatgacgccgacaatacgcctgagaaaatggccgtgtattatctcgtgctcggcctgatg
aatgacgaaaaggcaggcgccgtggtagggaaattccgcgtcatcaatgcggcaaagacg
ctgctgacgaggtttatcaatatcgaaacgatctgttttcagtggatggcccagggaggc
agatggaagtggttcaaaatcgccacgatcccaggcaccaacttcgcgatccgtagaagc
attatcgaaaagctcggaggctgggatgacaaagcgctcgctgaggatactgagctgacc
atccgggtatataatctcggctatcacatccgctttttccctgccgccatcacgtgggag
caggagccggaaacatggaaggtatggtggcgccagcgcacccgatgggcgcgcggcaat
caatatgtcgtgctcaaatttttggcgcagttttttaagctgaaacgaaaacggattatc
tttgatttgttttattttttctttacgtacttcctgtttttctttggcgtgatcatgtca
aatgcgatttttgtagtgaatttgttttatgatttgcatttgtctgttggatttttggca
atgattctctggattttggcgtttttcttatttatgacagaggtcatgattacgttgagc
attgaaaaaacagaaatgaacaggcaaaacttttttatcgtatttctcatgtacttcaca
tactcgcaggcatggattgtgcttgtgatctactctttattcatagaaatcaagcaccgt
ttattcaagcaggaggtcaaatggtacaagacagaacgatacaatcaacataaaagcggg
tga

DBGET integrated database retrieval system