KEGG   Bacillus sp. JS: MY9_0487Help
Entry
MY9_0487          CDS       T02027                                 

Definition
(GenBank) D-alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00473  D-Alanine metabolism
bjs01100  Metabolic pathways
bjs01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MY9_0487
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    MY9_0487
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bjs01011]
    MY9_0487
Enzymes [BR:bjs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MY9_0487
Peptidoglycan biosynthesis and degradation proteins [BR:bjs01011]
 Precursor biosynthesis
  Racemase
   MY9_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFI27026
UniProt: I0F0M0
LinkDB All DBs
Position
514205..515374
Genome map
AA seq 389 aa AA seqDB search
MSTKPFYRDTWAEIDLSAIKENVSNMKEHIGEHVQLMAVVKANAYGHGDAETAKAALDAG
ASCLAVAILDEAISLRKKGLKAPILVLGAVPPEYVAIAAEYDVTLTGYSVEWLQEAARHT
KKGSLHFHLKVDTGMNRLGVKTEEEVQNVMAILDRNPRLKCKGVFTHFATADEKERGYFL
KQFERFKELIAPLPLKNLMVHCANSAAGLRLKKGFFNAVRFGIGMYGLRPSADISDEIPF
QLRPAFTLHSTLSHVKLIRKGESVSYGAEYTAEKDTWIGTVPVGYADGWLRKLKGTDILV
KGKRLKIAGRICMDQFMVELDQEYPPGTKVTLIGRQGDEYISMDEIAGRLETINYEVACT
ISSRVPRMFLENGSIMEVRNPLLQVNTSN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaaacctttttacagggatacgtgggcggaaattgacttgtccgcgataaag
gaaaatgtcagcaatatgaaagaacatatcggtgaacatgtccagctaatggcagttgta
aaagcaaacgcctacgggcatggtgatgcagaaacagcaaaggctgctcttgacgcaggt
gcttcatgcttggccgtagccattttggatgaagcgatttcactgcgtaaaaagggcttg
aaggcgcctatattggtgctcggcgcggttcccccggagtatgtggcaatcgctgcggag
tatgacgtgaccttaacgggttattccgttgaatggcttcaggaggcagcccgccacacg
aaaaaaggttctcttcattttcatctgaaggtcgatacggggatgaacaggcttggtgtc
aaaacagaggaagaagttcagaatgtgatggccattcttgaccgcaacccccgtttaaag
tgcaaaggggtatttacccattttgcgacagcagatgaaaaagaaagaggctatttctta
aagcagtttgagcgttttaaagagctgattgctccgctgccgttaaagaatttgatggtc
cactgcgcaaacagcgccgccggacttcggctgaaaaaaggcttttttaatgcagtcaga
ttcggcatcggcatgtatggccttcgcccgtctgctgacatttcggacgagataccgttt
cagctgcgtccggcattcaccctgcattcgacgctgtcgcatgtcaaactgatcagaaaa
ggcgagagcgtcagctacggagccgagtacacagcagaaaaagacacatggatcgggacg
gtgcctgtaggctatgcggacggctggctccgaaaattgaaggggaccgacatccttgtg
aagggaaaacgcctaaaaattgccggtcgaatttgcatggaccaatttatggtggagctg
gatcaggaatatccgccgggcacaaaagtcacattaataggtcggcagggagatgaatat
atttccatggatgagattgcaggaaggctcgaaaccattaactatgaagtggcctgtaca
ataagttcccgcgttccccgtatgtttttggaaaatgggagtataatggaagtaagaaat
cctttgttgcaggtcaatacaagcaattag

DBGET integrated database retrieval system