KEGG   Bacillus sp. JS: MY9_0829Help
Entry
MY9_0829          CDS       T02027                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00627  Aminobenzoate degradation
bjs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MY9_0829
Enzymes [BR:bjs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     MY9_0829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFI27368
UniProt: I0F1L2
LinkDB All DBs
Position
870886..872343
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQYIGGKWQEGSSPNVLENKNPYTQKTFTTFRKATADDVDEAYRAAALAKKK
WDAVNPFEKRSILEKAVTYIEENEEAIIYLIMEELGGTRLKAAFEIGLVKNIIKEAATFP
VRMEGKILPSTIDGKENRLYRVPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFENAGIPEGLLNVVVTDIAEIGDSFVEHPVPRIISFTGSTKVGSYIG
QLAMKHFKKPLLELGGNSAFIVLEDADIEYAVNAAVFSRFTHQGQICMSANRVLVHSSIY
DKFLELYQAKVESLKVGDPMDPDTIIGPLINSRQTDGLMKSVEQAIEEGAVPVKLGGFNG
TIVEPTILKDVKPFMSIAKEELFGPVVSFMKFDSEDEAVDIANETPFGLSGAVHTSNLER
GVAFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHEK
RSFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagagttgaataaacagtatatcggcgggaaatggcaggagggcagc
agcccaaatgtattggaaaacaaaaatccttatactcaaaaaacattcacaacattccgt
aaagcgactgctgacgatgtagatgaagcgtaccgggcagcggcgctggcgaagaaaaaa
tgggatgcggtcaatccgttcgaaaaaagatccattctagaaaaagccgtcacgtatatc
gaagaaaacgaagaagccatcatttatttgattatggaagagcttgggggaacaaggctc
aaagcagcctttgaaatcggtcttgtcaaaaacatcataaaagaagcggcaacgttccct
gtccgcatggaaggtaaaattcttccgtccacaatagacggaaaggaaaacagattatat
cgcgtgccggcaggtgttgtcggtgtcatcagtccatttaacttcccattctttttatct
atgaaatcagtggcgcctgcactcggagccggcaatggcgttgtgttaaagccgcatgag
gaaacgcctatatgcggcggaacgctgattgcgaaaatttttgagaacgcgggaatccca
gagggtctgctgaatgttgttgtcacagacattgctgaaatcggagacagcttcgttgag
catccagtgccgcgaattatctcatttaccggttctacgaaagtcggcagctacatcggg
cagcttgcgatgaagcattttaaaaagccgcttcttgagcttggcgggaatagcgccttc
atcgtgcttgaggatgcagatatagaatatgcggtcaacgctgcggtgttcagccgattt
acacatcaaggacaaatttgcatgtcagccaatcgcgtgcttgtccattcatctatttat
gataagttccttgagctctatcaggcaaaagtggaatcgctgaaagtcggcgatccaatg
gaccctgatacgattatcgggccattaatcaacagcagacagacggacgggctgatgaag
tctgttgagcaagcaattgaagaaggcgctgtaccggtgaagcttggcggatttaacggg
acgattgtggaaccgacgatcttaaaagacgtcaaaccgttcatgagcattgccaaggaa
gagctgttcgggccggtcgtctcctttatgaagtttgattcagaagacgaagcggtggat
atcgcaaacgaaacgccgtttggattgagcggtgccgtacatacgtcaaatcttgagcgc
ggcgtggcttttgcgaaacgcattgaaacaggcatgattcacgttaatgacacgaccatt
aatgatgaaccgaatgtagccttcggcggtgaaaagcaatcaggcctcggccgtttgaac
ggtgagtggagccttgaagaatttacaacgctgaaatggatctcggttcagcacgaaaaa
cgcagcttcccttattaa

DBGET integrated database retrieval system