KEGG   Bacillus sp. JS: MY9_1723Help
Entry
MY9_1723          CDS       T02027                                 

Definition
(GenBank) PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bjs  Bacillus sp. JS
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bjs01001]
    MY9_1723
Enzymes [BR:bjs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MY9_1723
Protein kinases [BR:bjs01001]
 Serine/threonine kinases: Other
  Bacterial family
   MY9_1723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Kdo Haspin_kinase RIO1 Seadorna_VP7 Pkinase_fungal CwsA
Motif
Other DBs
NCBI-ProteinID: AFI28260
UniProt: I0F454
LinkDB All DBs
Position
1697493..1699439
Genome map
AA seq 648 aa AA seqDB search
MLIGKRISGRYQILRVIGGGGMANVYLAEDIILDREVAIKILRFDYANDNEFIRRFRREA
QSASSLDHPNIVSIYDLGEEDDIYYIVMEYVEGMTLKEYITANGPLHPKEALNIMEQIVS
AIAHAHQNQIVHRDIKPHNILIDHMGNIKVTDFGIATALSSTTITHTNSVLGSVHYLSPE
QARGGLATKKSDIYALGIVLFELLTGRIPFDGESAVSIALKHLQAETPSTRRWNPSVPQS
VENIILKATAKDPFHRYETAEDMEADIKTAFDADRLNEKRFTIQEDEEMTKAIPIIKDEE
LAKAAGEKEADLTTAQENKTKKNGKRKKWPWVLLTICLVFITAGILAVTVFPSLFMPKDV
KIPDVSGMEYEKAAGLLEKEGLQVDSEVLEISDEKIEEGLMVKTDPKAETTVKEGATVTI
YKSTGKAKTEIGNVTGQTVDQAKKALKDQGFKHVTVNEVNDEKNAGTVIDQNPSAGTELV
PSEDQVKLTVSIGPEDITLRDLKTYSKEAASGYLEDNGLKLVEKEAYSDDVPEGQVVKQK
PAAGTAVKPGNEVEVTFSLGPEKKPAKTVKEKVEIPYEPENEGDELQVQIAVDDADHSIS
DTYEEFKIKEPTERTIELKIEPGQKGYYQVMVNNKVVSYKTIEYPKDE
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
gtgctaatcggcaagcggatcagcgggcgttaccaaattctccgcgtcataggcggcggg
ggaatggccaacgtgtatttagctgaggatattattctagaccgtgaagtcgcgatcaaa
atcctgcggtttgactatgcaaatgacaatgaatttattaggcgtttccgcagagaagcc
caatccgcatcaagcctcgatcacccgaatattgtcagcatttacgacttgggcgaggaa
gatgatatttattatattgtcatggaatacgtcgaaggcatgacgcttaaagaatacata
acagcaaatgggccgcttcaccctaaagaagcgctgaacatcatggagcaaattgtctca
gccatcgctcatgcccatcaaaaccagattgttcacagagatatcaagccgcataacatt
ttgattgaccacatggggaatatcaaagtaacggattttggaattgcgacggcattaagt
tcgaccacaatcacccataccaattctgtcctgggctcagtccactacttatcacctgaa
caggcccggggcggcttagcgacaaaaaaatcggatatttatgcccttggaatcgttcta
tttgagcttttaacgggccgtattccgtttgacggagagtcagcagtcagcatcgccttg
aagcatcttcaagcggaaactccttcgactagaaggtggaacccgtcagtcccccaaagc
gttgaaaacatcatactaaaggcaacggccaaagacccttttcatcgctacgaaacggct
gaagacatggaagctgacataaaaaccgcttttgatgctgacagactcaatgaaaagaga
tttacgattcaagaagatgaagagatgacaaaagcgataccgatcattaaagatgaagaa
ctcgctaaagctgctggcgaaaaagaagctgatttgacaaccgcacaagaaaacaaaaca
aagaaaaacggcaaaagaaaaaagtggccgtgggttttgctcacgatatgcctcgttttt
atcacggctggaattcttgctgtcaccgtttttccgtcgctttttatgcctaaggatgtc
aaaatacctgatgtctccggaatggaatacgaaaaagcagcaggcctcttggaaaaagaa
ggtttacaagttgattccgaggtgttggaaatctcagacgaaaaaattgaagagggcctg
atggtaaaaacggatcccaaagcggaaaccacagtcaaagaaggcgccacggtcaccatt
tataagagcaccggaaaagcaaagacggagatcggtaatgtgacaggccaaacggtcgac
caggcaaaaaaagcgctgaaggaccaagggtttaaacatgtaacggtaaatgaagtgaat
gacgagaaaaacgcgggcactgtcattgaccaaaatccttcagcagggactgagcttgtc
ccgagtgaagatcaagttaaactcacagtcagtatcggccccgaagacattacgcttaga
gacttgaaaacctacagtaaagaagcggcgtctggatatctggaagacaacggattgaag
cttgtagaaaaagaagcatactcagatgatgttccagaaggacaggttgtcaaacaaaaa
ccagcagcaggtacggcagtaaagccgggaaatgaagtggaagtgacattctctctagga
cccgagaaaaaacctgcgaaaacagtgaaagaaaaggtcgagatcccttatgaaccagaa
aatgaaggggacgaacttcaagtgcaaatcgcagttgacgatgcggatcacagcatctct
gacacttacgaagaatttaagataaaagagccgactgaacgaacgatcgaactaaagatt
gaacccggccaaaaagggtactatcaagtaatggtaaacaataaagttgtcagctacaaa
accattgagtatccaaaagatgaataa

DBGET integrated database retrieval system