KEGG   Bacillus sp. JS: MY9_2684
Entry
MY9_2684          CDS       T02027                                 

Definition
(GenBank) LevG
  KO
K02771  fructose PTS system EIID component
Organism
bjs  Bacillus sp. JS
Pathway
bjs00051  Fructose and mannose metabolism
bjs02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MY9_2684
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    MY9_2684
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bjs02000]
    MY9_2684
Transporters [BR:bjs02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    MY9_2684
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: AFI29217
UniProt: I0F6W1
LinkDB
Position
complement(2626133..2626960)
AA seq 275 aa
MEKEKRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYAPGAKRNEALQR
HLEWFNTHPWLTAPIFGVTAAMEEEMANNKGIDGKAISGMKIGLMGPIAGVGDPIFWGTI
RPVLAALGASLALGGNIAGPLLFFFLLNAIRLSTKYYGLKYGYVKGMEILQDLAGNRIQK
LTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQTVQNVLDSIMPGALPLGL
TLLVAWMLRKGVNPLLIICGIFIIGILGFWAGFLV
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagaaagaaaaacgattaacgaaaaaagaaattttcagcatgtttattcgttcaaat
tttttgctcggttcctttaacttcgaacgtgtgcaggcaatgggatattgttatgtcatg
ataccggcgatcaaaaaattgtacgctcccggagcgaaaagaaacgaagccctgcagcgc
catttggaatggtttaatacacacccgtggctgacagcgcctatatttggcgtgacggca
gccatggaagaagaaatggcgaacaataaaggaattgatggaaaagcgataagcggaatg
aaaatcggtttgatgggaccaatagcgggcgtaggcgaccccattttctggggaacgatt
cgcccggtcttagctgccttaggagcctctcttgctttaggaggaaacattgccggccct
ttgctattctttttcttgctgaatgctataagattaagcacaaaatattacggattaaag
tatggctatgtgaaaggaatggagatccttcaggatttagcggggaatcgcattcaaaag
cttacagagggtgcttcgattctcgggttatttgttatgggggccctcgtgtccaaatgg
accaccatcaacattccaatcgttgtatccaggattaaggatgaaagcggcaaagtagat
gttcaaacggtacaaaatgtgttagacagcattatgccgggtgcgctgccgctcggatta
acgttattggtggcttggatgctgcgcaaaggagtgaaccctcttctcattatttgcggc
atctttatcatcgggattctcgggttttgggctggattcttagtataa

DBGET integrated database retrieval system