KEGG   Bacillus sp. JS: MY9_2685
Entry
MY9_2685          CDS       T02027                                 

Definition
(GenBank) PTS system mannose-specific transporter subunit IIC
  KO
K11196  fructose PTS system EIIC component
Organism
bjs  Bacillus sp. JS
Pathway
bjs00051  Fructose and mannose metabolism
bjs02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MY9_2685
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    MY9_2685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bjs02000]
    MY9_2685
Transporters [BR:bjs02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    MY9_2685
SSDB
Motif
Pfam: EII-Sor
Other DBs
NCBI-ProteinID: AFI29218
UniProt: I0F6W2
LinkDB
Position
complement(2626982..2627791)
AA seq 269 aa
MSSLQIILLLVIAAITGIASVLDEGQTHRPLVACTLVGLVLGDLKTGIILGGTLELMALG
WMNVGLAMAPDTAIASVISTILVITADQGIGEGIAVAVALAAAGQALTIFVRTITVFFIH
RADKYAKEGNIKGIEIMHITAMVFQALRVMIPTLIVALISVSAVQAFLGNIPDVITKGLQ
IGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFNLVGFGALGLCLALLYQQVIQ
KQSAHGAVAAASDSGSVAVYDDDDDDLDA
NT seq 810 nt   +upstreamnt  +downstreamnt
atgtcttcattacaaattattttgttgttagtcattgcagcaattaccggaatcgcaagt
gtattggatgaagggcagacacaccggccgcttgtggcctgtacgctagttggcctggtg
ctgggggatttaaaaacggggattatccttggaggcacactggagctgatggcgctcggc
tggatgaacgtcgggcttgccatggcgcctgatacggcgatcgcttctgtcatctcaacc
attttagttattacagctgatcagggaattggcgaagggattgctgtcgctgttgctttg
gcagctgcgggtcaggcgctgacgatttttgttcggacgatcactgtctttttcattcac
cgcgctgacaaatatgcaaaagaaggaaatataaaaggaattgaaattatgcatattacc
gcgatggtgtttcaagctttgcgcgtcatgattcctacattgattgttgctttaattagt
gtcagcgctgttcaggcattcctgggaaatattcctgatgtcattacaaaaggactgcaa
ataggcggaggcattattgtggttgtcgggtatgccatggtgatcaatatgatgaatatt
ccttatttaaagccatttttctatatcggtttcttattagcggcgtttaccgattttaac
ttagtgggattcggagcccttggtctttgtctggcgcttttatatcagcaggtgatacaa
aaacaaagcgctcacggagcagtcgcggccgcatcagacagtggcagtgttgctgtttat
gatgacgatgatgacgatcttgatgcctaa

DBGET integrated database retrieval system