KEGG   Bacillus sp. JS: MY9_2686
Entry
MY9_2686          CDS       T02027                                 

Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IIB component
  KO
K11195  fructose PTS system EIIB component [EC:2.7.1.202]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00051  Fructose and mannose metabolism
bjs02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MY9_2686
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    MY9_2686
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bjs02000]
    MY9_2686
Enzymes [BR:bjs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     MY9_2686
Transporters [BR:bjs02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    MY9_2686
SSDB
Motif
Pfam: PTSIIB_sorb Msg2_C
Other DBs
NCBI-ProteinID: AFI29219
UniProt: I0F6W3
LinkDB
Position
complement(2627808..2628299)
AA seq 163 aa
MMNIVLTRIDDRFIHGQILTRWIKVHAADRIIVVSDDIAQDEMRKTLILSVAPSNVKASA
VSVSKMAKAFHSPRYEGVTAMLLFENPSDIVSLIEAGVPIKTVNVGGMRFENQRRQITKS
VSVTEQDIKAFETLSDKGVKLELRQLPSDASEDFVQILRNVTK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgatgaacattgtgttaacaagaattgatgaccgctttattcacggccaaatcctgaca
aggtggattaaagtacatgcggccgaccgaatcatcgttgtctccgatgatattgctcag
gatgaaatgagaaaaacgctgatcctatctgttgcgccttcaaatgttaaggcgagtgcc
gtctctgtttctaaaatggcaaaagcctttcatagtccgcgctatgaaggagtaacagca
atgctcttgtttgaaaatccgtccgatatcgtatccctcatagaagcaggcgtaccgatc
aaaaccgtaaacgtcgggggaatgcgttttgaaaatcaacgcaggcaaatcacaaaatca
gtcagtgtcacagagcaagatataaaggcatttgaaacattaagtgacaagggcgtgaaa
ctggaattaaggcagctgccttcagatgccagtgaagattttgtacagatattacggaac
gtaacaaaataa

DBGET integrated database retrieval system