KEGG   Bacillus sp. JS: MY9_2912Help
Entry
MY9_2912          CDS       T02027                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00010  Glycolysis / Gluconeogenesis
bjs00030  Pentose phosphate pathway
bjs00051  Fructose and mannose metabolism
bjs00052  Galactose metabolism
bjs00680  Methane metabolism
bjs01100  Metabolic pathways
bjs01110  Biosynthesis of secondary metabolites
bjs01120  Microbial metabolism in diverse environments
bjs01130  Biosynthesis of antibiotics
bjs01200  Carbon metabolism
bjs01230  Biosynthesis of amino acids
bjs03018  RNA degradation
Module
bjs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bjs_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MY9_2912
   00030 Pentose phosphate pathway
    MY9_2912
   00051 Fructose and mannose metabolism
    MY9_2912
   00052 Galactose metabolism
    MY9_2912
  09102 Energy metabolism
   00680 Methane metabolism
    MY9_2912
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    MY9_2912
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bjs01009]
    MY9_2912
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bjs03019]
    MY9_2912
Enzymes [BR:bjs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MY9_2912
Protein phosphatases and associated proteins [BR:bjs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MY9_2912
Messenger RNA biogenesis [BR:bjs03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MY9_2912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AFI29445
UniProt: I0F7I9
LinkDB All DBs
Position
complement(2850917..2851876)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMHEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
ETKHTVEQNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggggtattaacgagcggcggggattccccgggaatgaacgcagcagtt
cgcgcagtagtcagaaaagcgatttatcatgacgttgaagtttacggtatttacaacgga
tacgcaggattaatcagcggaaagattgaaaagcttgaactcggatcagtaggcgatatt
atacatcgcggaggcacaaagctttatacggcaagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaaggtatagaaaacttgaagaagcttggtattgaaggccttgttgttatc
ggcggagacggttcctatatgggtgcgaaaaaattaacggaacacgggtttccatgtgta
ggtgtaccgggtacaattgataatgacattccgggcacggattttaccatcggtttcgat
acagctttaaatacagtaattgacgcaattgataagattcgagatacagcgacttctcat
gaacgtacatatgtgatcgaagtaatgggccgtcatgccggcgatatcgcattgtgggcc
ggtcttgcagggggcgcggaatcgatcttaatccctgaggcagactatgacatgcacgaa
atcattgcccgcttaaaacgcggccacgaacgcggcaagaagcacagcattatcattgtt
gccgaaggtgtaggcagcggggttgaattcgggaaacgcattgaagaagaaacaaatctt
gaaactagggtatctgtattgggccatatccagcgcggaggttctccgagtgctgctgac
cgtgtgttggcaagccgtctcggcgcatatgcagttgaactgctgcttgaaggaaaaggc
ggacgctgtgtaggtatacaaaacaataagcttgtagaccatgatattatagaaatattg
gagacaaaacacacagttgagcaaaacatgtatcagctttcaaaagaactgtctatctaa

DBGET integrated database retrieval system