KEGG   Bacillus sp. JS: MY9_3326Help
Entry
MY9_3326          CDS       T02027                                 

Definition
(GenBank) YusN
Organism
bjs  Bacillus sp. JS
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Coat_F Nore1-SARAH
Motif
Other DBs
NCBI-ProteinID: AFI29859
UniProt: I0F8Q3
LinkDB All DBs
Position
3251963..3252295
Genome map
AA seq 110 aa AA seqDB search
MNQQNQKISNPQTPVPTTSEMNDRDFVNELLTTEKYMTTAYCTALHEFSHESLYQDIQSI
FDESQKAQRKLYDLMFQYGWYSVEAEDAQKLQQSYQKFQQTIQQQSPYQQ
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacaaaatcaaaaaatcagcaaccctcagacacctgtaccgacaacatcggaa
atgaatgacagagatttcgtcaacgaactgctgacaaccgaaaaatacatgacaacagct
tattgcacagcattgcacgaattcagccacgagtctctttatcaggatattcaatccatt
tttgatgagtcacaaaaagcgcaaagaaaactgtatgacctcatgttccaatatggatgg
tattctgttgaagcggaggatgcccaaaagctgcagcaatcctatcaaaaattccagcag
accattcagcagcagtctccttatcagcagtaa

DBGET integrated database retrieval system