KEGG   Bacillus sp. JS: MY9_3651Help
Entry
MY9_3651          CDS       T02027                                 

Definition
(GenBank) high affinity ribose transport protein RbsD
  KO
K06726  D-ribose pyranase [EC:5.4.99.62]
Organism
bjs  Bacillus sp. JS
Pathway
bjs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MY9_3651
Enzymes [BR:bjs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.62  D-ribose pyranase
     MY9_3651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RbsD_FucU
Motif
Other DBs
NCBI-ProteinID: AFI30183
UniProt: I0F9M7
LinkDB All DBs
Position
3580434..3580829
Genome map
AA seq 131 aa AA seqDB search
MKKHGILNSHLAKLLADLGHTDKVVIADAGLPVPDGVLKIDLSLKPGLPAFQDTAAVLAD
EMVVEKVIAAAEIKTSNQENARFLENLFSKQKIEYLSHEEFKLLTKEAKAIIRTGEFTPY
ANCILQAGVLF
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacacggtatactaaacagccatcttgccaagcttttagctgaccttggccac
actgataaagttgtcattgcagatgccggattgccggtccctgacggcgttttgaaaatt
gatctttcattaaagccgggtctcccggctttccaagatacagcggcagtgctcgctgac
gagatggtcgtcgaaaaagtcattgccgcagctgaaataaaaacatctaatcaagagaat
gcgagatttctagaaaatcttttctctaaacaaaagattgaatacctttcgcacgaggag
tttaagctgctgacaaaagaagcaaaagccatcataagaacgggtgaatttacaccatat
gccaactgcatcctgcaggcgggtgtgcttttctag

DBGET integrated database retrieval system