KEGG   Bacillus sp. JS: MY9_3653Help
Entry
MY9_3653          CDS       T02027                                 

Definition
(GenBank) ribose transport system permease RbsC
  KO
K10440  ribose transport system permease protein
Organism
bjs  Bacillus sp. JS
Pathway
bjs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MY9_3653
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bjs02000]
    MY9_3653
Transporters [BR:bjs02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    MY9_3653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: AFI30185
UniProt: I0F9M9
LinkDB All DBs
Position
3582328..3583296
Genome map
AA seq 322 aa AA seqDB search
MKTEQLQTEHKRIHFDGVMQKLGPFLGLFILVIIVSILNPSFLEPLNILNLLRQVAINGL
IAFGMTFVILTGGIDLSVGAILALSSALVAGMIVSGVDPVLAIILGCIIGAMLGMINGLL
ITKGKMAPFIATLATMTVFRGLTLVYTDGNPITGLGTNYAFQMFGRGYFLGIPVPAITMV
LAFVILWVLLHKTPFGRRTYAIGGNEKAALISGIKVTRVKVMIYSLAGLLSALAGAILTS
RLHSAQPTAGESYELDAIAAVVLGGTSLSGGRGRIVGTLIGVLIIGTLNNGLNLLGVSSF
YQLVVKGIVILIAVLLDRKKSA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggaacaactgcaaacagaacacaaacggattcacttcgacggagtcatgcaa
aaactcggcccgtttcttggtttatttattctcgtaatcattgtatctattttaaatccc
agctttcttgaaccgctgaatattttaaacctgcttcgccaggtcgccattaacggatta
atcgcgttcggcatgacgtttgtgattttgacaggcggcattgatctttctgtcggcgct
attcttgctctgtccagcgctttagttgcgggaatgattgtatccggtgttgatccggtt
ctcgcgatcatccttggctgtatcattggtgccatgctcggcatgatcaacggattattg
atcacaaaaggaaaaatggcgccctttatcgccacacttgcgactatgactgtgtttcgc
ggactgacgcttgtgtatactgacggaaatccaattaccggacttggcacaaactacgct
tttcagatgttcggacgcggttactttttaggcattcctgtaccggccattacgatggtt
cttgcctttgtcatcctttgggtgcttcttcataaaacaccatttggacgccgaacatac
gctatcggcggcaacgaaaaagccgcgctcatttcaggcataaaagtgacacgcgtgaaa
gtgatgatctattctttagccggacttttatccgctcttgcaggtgccatattgacttcc
cgcctgcattcagcccagccgactgccggggaatcgtacgaacttgatgctatcgcggca
gtcgtcttaggcgggacaagtctttccggcggccgcggacgcattgtcggcacgttaatc
ggggtgctgatcatcggcacacttaataacgggcttaatctgcttggcgtctcatcattt
tatcagctggttgtcaaagggattgtcatcttaattgcggttttgttagaccgcaagaag
tcagcatag

DBGET integrated database retrieval system