KEGG   Bacillus sp. JS: MY9_3860
Entry
MY9_3860          CDS       T02027                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00998  Biosynthesis of various secondary metabolites - part 2
bjs01100  Metabolic pathways
bjs01110  Biosynthesis of secondary metabolites
Module
bjs_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    MY9_3860
Enzymes [BR:bjs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     MY9_3860
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AFI30392
UniProt: I0FA86
LinkDB
Position
complement(3765851..3767050)
AA seq 399 aa
MEITPSDVIKTLPRQEFSLVFQKVKELEKTGAHIINLGQGNPDLPTPPHIVEALREASLN
PSFHGYGPFRGYPFLKEAIAAFYKREYGVTINPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAEHYEMPLYEENGYLPDFEKIDPAVLEKAKLMFLNYPNNPT
GAVADAAFYAKAAAFAKEHHIHLIHDFAYGAFEFDQKPASFLEAEDAKAVGAELYSFSKT
FNMAGWRMAFAVGNEKIIQAVNEFQDHVFVGMFGGLQQAASAALSGDPEQTESLKRIYKE
RIDFFTALCEKELGWKMEKPKGTFYVWAEIPNTFETSHQFSDYLLEHAHVVVTPGEIFGS
NGKRHVRISMVSKQEDLREFVMRIQKLNLPFGSLQETSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaataacaccgtccgatgtcatcaagacacttccaaggcaggagttttctctcgtt
tttcaaaaggtaaaggaattggaaaaaacgggggcccacatcattaatctcggacaagga
aaccctgaccttcccactccgccgcatatcgtcgaggctttgcgggaggcgtctctgaat
ccttcgtttcatggatacggcccattcagaggttatccttttttgaaggaagcaatcgct
gctttctataaaagagaatacggcgtgacaatcaatcctgaaacggaggtcgcccttttc
ggaggcgggaaagccggtttgtatgtgctgacacaatgcctgctcaatccgggagacatc
gctttagtcccgaatccaggctaccctgaatatttatcagggattacgatggcgcgagct
gagcattacgaaatgccgctgtatgaagaaaatggctatctgccggattttgaaaagatt
gatccagccgtgctggaaaaagcgaagcttatgtttttaaactatccgaacaaccccact
ggagctgtggctgatgcggctttttatgcaaaagcggctgcttttgcgaaagagcatcat
atccatttgattcatgactttgcatacggggcgtttgaattcgatcaaaaaccggccagc
tttcttgaggcagaggatgccaaggctgtcggagcagagctttattcattttcaaaaaca
tttaatatggcaggctggagaatggcgtttgcggttgggaatgaaaagatcattcaggcc
gtcaatgaatttcaggatcatgtatttgtcggcatgttcggcgggctgcagcaggcagcg
agtgcggcgctttccggagatccggagcaaacggaatcgctgaaacgaatttataaagaa
cgaattgacttttttacggcgctttgcgaaaaggaattgggctggaagatggaaaagcca
aaaggaaccttttacgtatgggctgaaattccgaatacgtttgagacatctcaccaattt
tccgattacttgctggagcatgcccatgtcgtagtcacaccgggcgaaattttcggaagc
aacggaaaaaggcatgtcagaatctcaatggtgtcgaagcaagaggatctgcgggaattt
gtcatgcggattcaaaaactgaacctgccgttcgggtcattacaagaaacatcccgctaa

DBGET integrated database retrieval system