KEGG   Bacillus sp. JS: MY9_4217Help
Entry
MY9_4217          CDS       T02027                                 

Definition
(GenBank) acetyl-transferase
Organism
bjs  Bacillus sp. JS
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_9 Acetyltransf_CG Acetyltransf_3 Acetyltransf_13 PanZ
Motif
Other DBs
NCBI-ProteinID: AFI30749
UniProt: I0FB93
LinkDB All DBs
Position
complement(4091958..4092479)
Genome map
AA seq 173 aa AA seqDB search
MIMKMTHLNMKDFNKPNEPFVVFGRMIPAFENGVWTYTEERFSKPYFKQYEDDDMDVSYV
EEEGKAAFLYYLENNCIGRIKIRSNWNGYALIEDIAVAKDYRKKGVGTALLHKAIEWAKE
NHFCGLMLETQDINVSACHFYAKHHFIIGAVDTMLYSNFPTANEIAIFWYYKF
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgaaaatgactcatttgaatatgaaagatttcaataaaccaaacgaacctttc
gttgtttttgggagaatgatacctgcttttgaaaacggtgtttggacatatactgaggaa
cgattttccaaaccttattttaaacaatatgaagatgatgacatggatgttagttatgtt
gaagaagaggggaaagcggcttttttatattatcttgaaaacaactgcattggccggatt
aagatccgttctaactggaatgggtatgcactaatagaggacattgccgtggcaaaagac
tatagaaaaaaaggtgttggaacagcattattacataaagcgattgagtgggcaaaggag
aatcatttttgtggtcttatgcttgaaacccaagatattaatgtttcagcttgtcatttt
tatgccaaacatcactttataataggtgcggttgatacgatgctttattccaactttcca
acagcaaatgaaattgcgattttttggtactataaattttaa

DBGET integrated database retrieval system