KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_07750Help
Entry
BJ6T_07750        CDS       T01848                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase (NADH2)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00061  Fatty acid biosynthesis
bju00780  Biotin metabolism
bju01100  Metabolic pathways
bju01130  Biosynthesis of antibiotics
bju01212  Fatty acid metabolism
Module
bju_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bju00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BJ6T_07750
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BJ6T_07750
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    BJ6T_07750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bju01004]
    BJ6T_07750
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BJ6T_07750
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BJ6T_07750
Lipid biosynthesis proteins [BR:bju01004]
 Fatty acid synthase
  Component type
   BJ6T_07750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: BAL06068
UniProt: G7DJ30
LinkDB All DBs
Position
812619..813416
Genome map
AA seq 265 aa AA seqDB search
MEGLMKGKRGLIMGIANDHSIAWGMAKALHAHGAELAFTFQGEALGKRVKPLAEQLGVEL
VLPCDVEDIASVDATFAALREKWGKLDFVIHAIGFADKNELKGRYADTSRENFSRTMVIS
CFSFTEVAKRAAELMTEGGSMITLTFGASERAMPNYNVMGVAKAALEASVRYLASDFGPR
GIRVNAISAGPIRTLAGSGIGEARAMFGFMQKHSPLRRGVTLDELGGSALYLLSDLSGGV
TGEIHYVDSGYNVILMPRPDDLKPE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggaaggactgatgaaaggcaagcgcggtctgatcatgggcatcgccaatgatcattcg
atcgcctggggcatggcgaaggcgctgcatgcccacggtgccgagcttgccttcaccttc
cagggcgaggcgctgggcaagcgcgtcaagccattggcagagcagctcggcgtggaattg
gtgctgccttgcgacgtcgaggacatcgccagcgttgatgccaccttcgctgcactccgc
gagaaatggggcaagctcgatttcgtcatccacgcgatcggctttgccgacaagaacgag
ctcaagggccgctacgccgacaccagccgcgagaacttttcgcgcaccatggtgatctcc
tgcttctcgttcacggaggtcgcaaaacgcgccgccgagctgatgacggagggcggcagc
atgatcacgctgaccttcggcgcctcggagcgcgcgatgccgaactacaacgtgatgggt
gtggccaaggcggcgctggaggcctccgtgcgctacctcgcctccgatttcggaccgcgc
ggtatccgcgtcaacgccatctccgcaggccccatccgtacgctcgccggctcgggcatc
ggcgaggcgcgtgcgatgttcggcttcatgcaaaagcattcgccgctccgccgcggcgtc
acgctcgacgagctcggcggctcggcgctgtatctgttgtcggatctctccggcggcgtg
accggcgagatccactatgtcgattccggctacaacgtcatcctgatgccgaggccggac
gatttgaagccggaatga

DBGET integrated database retrieval system