KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_07760Help
Entry
BJ6T_07760        CDS       T01848                                 

Definition
(GenBank) hypothetical glutathione S-transferase like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bju00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BJ6T_07760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bju02000]
    BJ6T_07760
Enzymes [BR:bju01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BJ6T_07760
Transporters [BR:bju02000]
 Other Transporters
  Pores ion channels [TC:1]
   BJ6T_07760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_C_5
Motif
Other DBs
NCBI-ProteinID: BAL06069
UniProt: G7DJ31
LinkDB All DBs
Position
complement(813577..814173)
Genome map
AA seq 198 aa AA seqDB search
MIKLYWSPRSRSFTTLWLMEESGLPYERVLTDISTGAQKAPDYLKVNPMGKVPALSDGDA
ALGEAAAICAYIADRYPEAKLAPAVTDPRRARYLQWLFFSPGCIEPAIIQIFTKIEIPTS
TAAWGSATQVFDVLEAALAKGPWILGEEFSAADVTVGSGLNFAVRLFKMVPSRPAFDAYL
ARCMARPAFQRAEQIAAG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctctattggtcgccacgctcgcgctcgttcacgacgctctggctgatggaa
gagagcggcctgccctatgagcgcgtgctgaccgacatctcgaccggtgcgcagaaagcg
ccggattatttgaaggttaatccgatgggcaaggtgccggcgctcagcgacggcgatgcc
gcgctcggcgaagccgctgcgatctgcgcctatatcgccgaccgctatcccgaagcgaag
ctcgcgcccgcggtaaccgatccgcgtcgtgcgcgctatctgcaatggctgttcttttcg
ccgggctgcatcgagcctgccatcatccagatcttcaccaagatcgagatcccgacctcg
acggcggcctggggcagcgccacgcaggtgttcgacgtgctggaagctgcgctcgcgaag
ggaccgtggattctcggcgaggaattttcggccgccgacgtcacggtcggctccggcctg
aacttcgcggtccgcctgttcaagatggtgccgtcacgcccggccttcgatgcctatctc
gcgcgctgcatggcgcggccggcgttccagcgggcggagcagatcgcggcggggtga

DBGET integrated database retrieval system