KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_11230Help
Entry
BJ6T_11230        CDS       T01848                                 

Definition
(GenBank) phosphate ABC transporter permease protein
  KO
K02038  phosphate transport system permease protein
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bju00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BJ6T_11230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bju02000]
    BJ6T_11230
Transporters [BR:bju02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    BJ6T_11230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF456 DUF3333
Motif
Other DBs
NCBI-ProteinID: BAL06415
LinkDB All DBs
Position
1200951..1201796
Genome map
AA seq 281 aa AA seqDB search
MNPIYSRRRRKDIVVRGLCMAAAAFGVTWLALILITLLYNGIAGLNLEIFVADTPPPGST
EGGLRNAIVGSIIMTVLGVGIGAPLGLFAGTYLAEYGRNDRLTSVIRFINDILLSAPSII
IGLFIYGAVVVPMRGFSAIAGALALAVIVIPVVLRTTEDMLLLVPNALREAASALGLPRS
LVIKRIAYRAARSGLITGVLLATARVAGETAPLLFTALSNQFFSLGLNKTMANLPVTINN
FVQSPYAYWKQLAWSGALLITITVLALNIGARILGAERTAK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgatctattcacgccgccgccgcaaggacatcgtcgttcgcggtctctgcatg
gccgccgccgccttcggcgtcacctggcttgcgctgatcctgatcacgctgctctacaac
ggcatcgccggtctgaacctggagatctttgtcgcggacactccgcctccgggctcgacc
gaaggcggcctgcgcaacgccatcgtcggttcgatcatcatgaccgtgctcggcgtcggt
atcggcgcgccgctcggcctgtttgccggcacctatcttgccgagtacggccgcaacgat
cgcctgacctcggtgatccgcttcatcaacgacatcctcctgtcggcgccctcgatcatc
atcggcctgttcatctatggtgcggtggtggtgccgatgcgcggcttctcggcgatcgca
ggcgcgctcgcgctcgcggtcatcgtcatcccggtggtgctgcgcactaccgaggacatg
ttgctgctggtgccgaacgcgctgcgtgaggcggcgtccgcgctcggcctgccgcgctcg
ctggtgatcaagcgcatcgcttatcgtgccgcccgttccggcctcatcaccggcgtgctg
ctcgcgaccgcccgcgtcgccggcgagaccgcgccgctgctctttactgcgctgtcgaac
cagttcttcagcctcggcctgaacaagacgatggcgaacctgccggtcaccatcaacaac
tttgtccagagcccctacgcctattggaagcagctcgcctggagcggcgcgctgctgatc
acgattaccgtgcttgccctgaacattggcgcgcgcatccttggcgccgagaggaccgca
aaatga

DBGET integrated database retrieval system