KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_26450Help
Entry
BJ6T_26450        CDS       T01848                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bju00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BJ6T_26450
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bju03400]
    BJ6T_26450
Enzymes [BR:bju01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BJ6T_26450
DNA repair and recombination proteins [BR:bju03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BJ6T_26450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DUF4232
Motif
Other DBs
NCBI-ProteinID: BAL07923
UniProt: G7DBZ5
LinkDB All DBs
Position
2716406..2719072
Genome map
AA seq 888 aa AA seqDB search
MLRKLSTYRQKRDFEKTPEPSGKTAVAPSAQRRFVIQKHDATRLHYDLRLEFDGVFKSWA
VTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPEGQYGGGTVMLWDRGTWESEDPERGFQ
KGDLKFTLHGDKLHGSWVLVRMRHDRNGGKRTNWLLIKHRDEYASESDDILSEDKSVASG
RAMAEIADGKGRAPKPFMLAKGAKAKADAVWQSNRAEEPKGRTVRPAPGAALKRGTGAKT
KATTATNAKKVSEMPDFVAPQLCTPVERPPAADGWCHEIKFDGYRVQLRVEDGEATLKTR
KGLDWTDKFAAIAKEAGELPDVMIDGEIVALDHNGAPNFSSLQAALSDGKTEDLIFFAFD
LLFAEGLDCRRLPLGERKDRLRQLLDAGKRKSSQIRYVEHFESSGDAVLQSACKLELEGV
VSKKLDAPYRSGRTESWTKAKCRAGHEVVIGGWKTTNGKFRSLMAGVHRGDHLAFVGMVG
TGFGADTVKRIMPSLKAMEAGQSPFGGKNAPKKTRDVHWLKPELVAEIEFAGFTADGNIR
QAAFKGLRQDKPAEEVEAETPADTELAKPSARKRAVPSAGKRKDAGTAEVMGVVISKPDK
ELWPDGGDGEGVTKLDLARYFEAVGAWMIEHIKGRPCSILRAPDGIGGEKFFQRHAMQGT
SNLLELAKVSGDRKPYLQIDRVEGLAAVAQIGGVELHPWNCAPDAYDTPGRLVFDLDPAP
DVKFADVVDAAKEMRQRLSDVGMESFCKTTGGKGLHVVVPLLHGARDKVSWKEAKAFAQG
VCQWMADDDPERYLLNMSKKLRNGKIFLDYLRNDRLSTAVAPLSPRARDGATVSMPVTWA
QVKGDLDPKRYTVRTVPGLLARSKAWDGYDDAAISIKAAAKKLAGKKK
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcgaaaactctccacctaccgacagaaacgcgatttcgagaagacaccggagccg
tcgggcaagaccgcggtggcgccatcggcgcagcggcgcttcgtgatccagaagcacgat
gcgacgcggctgcactatgatctgcggctcgagttcgacggcgtgttcaagtcgtgggcg
gtcaccaagggaccctcgctcgatccgcatgacaagcggctggcggtcgaggtcgaggac
catccgctcgactatggcgatttcgaaggcacgattccggaaggacagtatggcggcggc
acggtcatgctctgggaccgcggcacctgggagtcggaggatcccgagcgcggtttccag
aagggcgacctcaagttcacgctccacggcgacaagctgcatggaagctgggtgctggtg
cggatgaggcatgaccgcaacggcggcaagcgcaccaactggctcctgatcaagcatcgc
gacgaatatgccagcgagagcgacgacattctaagcgaggacaagtcggtggcctccggc
cgcgcgatggcagagatcgccgatggcaagggccgcgcgccaaaaccgttcatgctggcg
aagggtgccaaggccaaggccgatgcggtctggcagtccaatcgtgccgaggagccgaaa
gggcgcaccgtcaggccggcgcccggcgcggcgttgaagcgcgggacgggcgcaaagaca
aaggcgacgaccgcgacaaatgcgaaaaaggtctcggagatgccggacttcgtcgcgccg
cagctctgcaccccggtcgagcggccgccggcggccgacggctggtgccacgagatcaag
ttcgacggctatcgcgtccagctccgcgtcgaggacggcgaggcgacgctgaagacgcgc
aagggcctcgactggaccgacaagttcgcggccatcgcgaaggaggcgggggagcttccc
gacgtcatgattgacggcgagatcgtcgcgctggatcacaacggcgcgccgaatttctcc
tcgctccaggccgcgctgtcggacggcaagaccgaggacctgatcttctttgccttcgac
ctcctgttcgccgaggggctcgattgccggcgcctgccactcggcgagcgcaaggaccgc
ctcaggcaactcctggacgcgggcaagaggaagtcgagccaaatccgctatgtcgagcat
ttcgagagcagcggcgatgccgtgctgcaatcggcctgcaagctcgagctcgaaggcgtg
gtgtcgaagaagctcgatgcgccttaccggtcggggcgaacggaaagctggaccaaggcc
aaatgccgcgccggccatgaggtcgtgatcggcggctggaagaccaccaacggcaaattc
cgctcgctgatggccggcgtgcaccgcggcgatcatctcgccttcgtcggcatggtcggc
accggcttcggcgcggacacggtcaagcgcatcatgccgtccttgaaggccatggaggcc
gggcaaagccccttcggcggcaagaacgcgccgaaaaagacgcgcgacgtgcactggctg
aagccggagctcgtcgccgagatcgagttcgccggcttcaccgccgacggcaatatccgc
caggccgccttcaagggcctgcggcaggacaagccggccgaggaggtcgaggcggaaaca
cccgccgataccgaactcgccaagccctcggccaggaagcgtgccgtgccgagtgcaggc
aagcggaaggatgccggcacggccgaggtgatgggtgtcgtcatctcgaagccggacaag
gagctgtggccggatggcggcgacggcgagggtgtcacaaagctcgatcttgcgcgctac
ttcgaggccgtcggtgcctggatgatcgagcacatcaagggccggccctgttcgatcctg
cgcgcgcctgatggcatcggcggcgaaaaattcttccagcgccatgccatgcagggcacg
tcgaacctgctggagctcgcgaaagtctcgggcgatcgcaagccgtatctgcagatcgat
cgcgtcgaggggctcgccgcggtcgcgcagatcggcggcgtcgagctgcatccctggaat
tgtgccccggacgcctacgatacgccgggccggctggtgttcgatctcgatcccgcgccg
gacgtcaaatttgcagatgtcgtggacgccgccaaggagatgcggcagcgcctttccgac
gtcggcatggagagcttttgcaagaccaccggcggcaagggcctgcacgtggtggtgccg
ctgctccacggcgcgcgcgacaaggtgagctggaaggaggccaaggcgttcgcgcaaggc
gtttgccagtggatggccgacgacgatcccgagcgctatctgctcaacatgtcaaagaag
ctgcgcaacggaaagatcttcctggattatttgcgcaatgaccgcctgtcgacggcggtg
gccccgctgtcgccccgtgcgcgcgatggcgcgaccgtgtcgatgcccgtgacgtgggcg
caggtgaagggcgatctcgatccgaagcggtacacggtgcggacggtgccgggtctgctg
gcgcgctcgaaagcctgggatggctatgacgacgcggcgatatcgatcaaggcggcggcg
aagaagctcgcggggaaaaagaagtag

DBGET integrated database retrieval system