KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_28280Help
Entry
BJ6T_28280        CDS       T01848                                 

Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00473  D-Alanine metabolism
bju00550  Peptidoglycan biosynthesis
bju01100  Metabolic pathways
bju01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bju00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BJ6T_28280
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJ6T_28280
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BJ6T_28280
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bju01011]
    BJ6T_28280
Enzymes [BR:bju01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BJ6T_28280
Peptidoglycan biosynthesis and degradation proteins [BR:bju01011]
 Precursor biosynthesis
  Amino acid ligase
   BJ6T_28280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: BAL08106
UniProt: G7DDW0
LinkDB All DBs
Position
2914309..2915295
Genome map
AA seq 328 aa AA seqDB search
MRITILFGGSNRERLVSVASAQALHQALPEADLWWWDVEDKVHVVQSKQLLEHARPFEDE
FKPGTSGIPLGQALDRAKTEGRVLVLGLHGGRAENGELQVMCEARGVPFTGSGSASSHLA
FDKIAAKHFAALGGVTPPANVALDEIDEAFAEYGRLIAKPARDGSSYGLIFVNARQDLVA
VRNAAKHEDYVIEPYIAGVEATCGVLERTDGSIISLPPIEIIPGEGNFDYAAKYLLKSTQ
EICPGRFAPEITAALKEQAMLAHRAMSCTGYSRSDFIVSDRGLIYLETNTLPGLTKSSLY
PKALKAEGIEFVDFLRGLVELAGRDVRK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcaccatcctcttcggcggctccaaccgggagcgtctggtttcggtcgcctca
gcccaggcgctacatcaggcgctgcccgaggccgatctctggtggtgggacgtcgaggac
aaggtgcatgtcgtgcagtcgaagcaactgctcgaacacgcccgtccgttcgaggacgag
ttcaagcccggcacatcgggcattccgctggggcaggcgctcgatcgggccaagacggag
ggccgcgtgctggtgctcggcctgcatggcggccgcgcggagaacggcgaattgcaggtg
atgtgcgaggcgcgcggcgtgcccttcaccggatcgggctcggcctcctcgcatcttgcc
ttcgacaagatcgcggccaagcatttcgccgcgctcggcggcgtgacgccgccggccaat
gttgcgctggacgagatcgacgaggccttcgccgaatacggccggctgatcgcaaagccg
gcgcgcgacggttcgagctatggcctgatcttcgtcaacgccaggcaggatctcgtcgcc
gtccgcaatgcggcgaagcacgaagactatgtgatcgagccctacatcgcgggcgtcgag
gcgacctgcggcgtgctggagcgcaccgacggctcgatcatctcgttgccgccgatcgag
atcattccgggcgagggcaatttcgactacgccgcaaaatatctcctgaagtcgacccag
gagatctgccccggccgttttgcgcccgagatcaccgctgcgctgaaggagcaggcgatg
ctggcgcatcgcgcgatgtcctgcaccggctattcccgctctgacttcatcgtctctgac
aggggcctgatctatctcgagaccaacacgctgcccgggctgaccaagtcctcgctctac
cccaaggcgctgaaagccgaaggcatcgagttcgtcgacttcctgcgtggcctggtcgag
ctcgccgggcgggacgtaagaaaataa

DBGET integrated database retrieval system