KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_43850Help
Entry
BJ6T_43850        CDS       T01848                                 

Definition
(GenBank) elongation factor TU
  KO
K02358  elongation factor Tu
Organism
bju  Bradyrhizobium japonicum USDA 6
Brite
KEGG Orthology (KO) [BR:bju00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bju03012]
    BJ6T_43850
   03029 Mitochondrial biogenesis [BR:bju03029]
    BJ6T_43850
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bju04147]
    BJ6T_43850
Translation factors [BR:bju03012]
 Eukaryotic Type
  Elongation factors
   BJ6T_43850
 Prokaryotic Type
   BJ6T_43850
Mitochondrial biogenesis [BR:bju03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BJ6T_43850
Exosome [BR:bju04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BJ6T_43850
  Exosomal proteins of breast cancer cells
   BJ6T_43850
  Exosomal proteins of colorectal cancer cells
   BJ6T_43850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: BAL09654
UniProt: G7D4Z5
LinkDB All DBs
Position
4489729..4490919
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKILAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETQNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKCDMVDDPELLELVELEVRELLSKYDFPGDKIPIIKGSALAALE
DSDKKLGHEAILELMKNVDSYIPQPERPVDQPFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGLRATQKTTVTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcaaagtttgaacgtaacaagccgcactgcaacatcggcaccatcggtcac
gtcgaccatggcaagacgtcgctgacggcggcgatcaccaagatcctcgccgagaccggc
ggtgcgacgttcaccgcgtacgaccagatcgacaaggcgccggaagagaaggcgcgcggc
atcaccatctcgaccgcgcacgtcgagtatgagacgcagaaccgccactacgcccacgtc
gactgccccggccacgccgactacgtgaagaacatgatcaccggcgccgcccagatggac
ggtgcgatcctggtcgtgtcggccgctgacggcccgatgccgcagacccgcgagcacatc
ctgctcgcccgccaggtcggcgtgcccgcgctcgtcgtgttcctcaacaagtgcgacatg
gtcgacgatccggagctcctcgagctcgtcgagctcgaagtccgcgagctgctctcgaag
tacgacttcccgggcgacaagatcccgatcatcaagggttcggcgctcgccgctctcgaa
gattccgacaagaagctcggccacgaggccatcctcgagctgatgaagaacgtcgactcg
tacatcccgcagccggagcgtccggtcgaccagcccttcctgatgccggttgaagacgtg
ttctcgatctcgggccgcggcaccgtcgtgaccggccgtgtcgagcgcggcatcgtcaag
gtcggcgaggaaatcgagatcgtcggtctgcgcgccacgcagaagaccacggtcacgggc
gtcgaaatgttccgcaagctgctcgatcagggccaggccggcgacaacatcggcgcgctg
ctccgcggcaccaagcgcgaggacgtcgagcgtggccaggtgctgtgcaagccgggttcg
gtcaagccgcacaccaagttcaaggctgaggcctacatcctcaccaaggaagagggcggc
cgccacaccccgttcttcaccaactaccgtccgcagttctacttccgcaccaccgacgtg
accggtgtcgtgcatctgccggaaggcaccgagatggtgatgccgggcgacaacatcgcg
atggaagtgcacctgatcgtgccgatcgcgatggaagagaagctccgcttcgcgatccgc
gaaggcggccgcaccgtcggcgccggcgtcgtcgcctcgatcatcgagtaa

DBGET integrated database retrieval system