KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_48480Help
Entry
BJ6T_48480        CDS       T01848                                 

Definition
(GenBank) carbonic anhydrase
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00910  Nitrogen metabolism
bju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bju00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BJ6T_48480
Enzymes [BR:bju01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     BJ6T_48480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_CA
Motif
Other DBs
NCBI-ProteinID: BAL10110
LinkDB All DBs
Position
4922708..4923403
Genome map
AA seq 231 aa AA seqDB search
MLFGAAAFGMAFAGGAIANGALAKEAKQPPKPENVLSPDASLKRLMEGNARYVSGVARRH
DFKHEREALAGGQNPFAAVLSCADSRIAPEYAFDSGRGDLFVCRVAGNFAGTETIASMEY
AVAVLNAPLILVLGHDACGAVDATLKAIKDNTSPPGHIPSLVDAIAPAAKAAMQQGGDVL
NKAIRQNVIDNVAKLKSAAPILNAAVEQGKLKVVGGIYRLTTGTVDLIAQG
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttggcgccgccgcgtttggcatggctttcgcgggcggagccatcgccaacggc
gccctggcaaaggaagccaaacagccgccgaagcccgagaacgtgctgtcgcccgatgcg
tcgttgaaacgactgatggagggcaacgcgcgctacgtctcgggtgtggcgcggcggcat
gatttcaagcatgagcgcgaagcgctggccggcgggcagaacccgttcgcggccgtgctg
agctgcgcggactcgcgcattgcgccggaatatgccttcgactcgggccgcggcgatctc
tttgtctgccgcgtcgccggaaactttgccgggaccgaaaccatcgccagcatggaatat
gcggtcgccgtgctcaacgcgccgctgatcctcgtgctcggccatgatgcctgcggcgcg
gtcgatgcgacgctgaaggcgatcaaggacaacacgtcgccgccgggacacattccctcg
ctggtcgatgcgatcgcgcccgccgcaaaggccgcgatgcagcagggcggggacgtgctc
aacaaggcgatccggcagaacgtgatcgacaacgttgccaagctgaagtcggccgcaccg
atcctcaacgcggccgtggagcagggcaagctgaaggtcgtcggcggcatctaccggctc
accacgggaacggtcgatctgatcgctcagggctga

DBGET integrated database retrieval system