KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_49260Help
Entry
BJ6T_49260        CDS       T01848                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00010  Glycolysis / Gluconeogenesis
bju00620  Pyruvate metabolism
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJ6T_49260
   00620 Pyruvate metabolism
    BJ6T_49260
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BJ6T_49260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAL10188
UniProt: G7D997
LinkDB All DBs
Position
5006777..5008294
Genome map
AA seq 505 aa AA seqDB search
MNKVEFLGVTQVPFAERYDNFIGGKFIAPISGKYFDNASPVNGQIVCKIARSDAQDVEAA
LDAAHAAKGAWGRTSVAERAAILNRIADRMEENLERLAIAETWDNGKPIRETRAADLPLA
IDHFRYFAGVVRAQEGSIGEIDHDTIAYHFHEPLGVVGQIIPWNFPLLMACWKLAPALAA
GNCVVLKPAEQTPASIMVWAEIIGDLLPPGVLNIVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFNDVTAEDDDFFDKAIEGFVMFALNQGEVC
TCPSRALVHADIYDRFMERALKRVAAIKQGDPRAADTMIGAQASSEQLAKILSYIDIGKQ
EGAKVLAGGGRAELGGDLSGGFYVQPTVFEGHNKMRIFQEEIFGPVVSVTTFKTDDEALA
IANDTLYGLGAGVWSRDANRCYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGVGRETH
KMMLDHYQQTKNLLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggtggaattcctcggcgtcacccaggttccctttgccgaacgctatgacaat
ttcatcggcggcaaattcatcgcgccaatctccggcaagtactttgacaacgcctcgccg
gtgaacggccagatcgtctgcaagatcgcgcgttccgatgcgcaggacgtcgaggccgcc
ctcgatgcggcgcacgccgccaagggcgcctggggacgcaccagcgtcgccgagcgcgcc
gcgatcctgaaccggatcgccgaccggatggaagagaatctggagcgccttgcgattgcc
gaaacctgggacaacggcaagccgatccgcgagacccgcgccgccgacctgccactcgcg
atcgatcatttccgctatttcgccggcgtggtgcgcgcacaggagggctcgatcggcgag
atcgaccacgacaccatcgcctatcatttccacgaaccgctcggcgtggtcggccagatc
atcccctggaacttcccgctgctgatggcgtgctggaagctcgcgccggcgctcgccgcc
ggcaattgcgtcgtgctcaagcccgctgagcagacgccggcctcgatcatggtctgggcc
gagatcatcggcgatctcctgccgcccggcgtcctcaacatcgtcaacggctttggcctc
gaagccggcaagccgctcgcgtccagcccgcggatcgcgaaaatcgccttcaccggcgag
accacgacgggccggctgataatgcaatatgccagccagaacctgatcccggtcacgctc
gagctcggcggcaagtcgccgaacatcttcttcaacgacgtcaccgccgaggacgacgac
ttcttcgacaaggcgatcgaaggttttgtgatgttcgcgctgaaccagggcgaggtctgc
acctgtccgagccgggcgctggtccacgccgacatctatgaccgcttcatggagcgtgcg
ctgaagcgcgtcgccgcgatcaagcagggcgacccgcgcgcggccgacaccatgatcggc
gcgcaggcatccagcgagcagctcgccaagatcctctcctatatcgacatcggcaagcag
gagggcgccaaggtgctggccggcggcggtcgtgccgagctcggcggcgatctgtccggc
ggcttctatgtccagccgacggtgttcgagggccacaacaagatgcgaatcttccaggag
gagatctttggtccggtcgtctcggtcacgaccttcaagaccgatgacgaagcgctcgcg
atcgccaacgacacgctctacggcctgggagccggcgtctggagtcgcgatgccaaccgc
tgctaccgcttcggccgggccatccaggccggccgggtctggaccaactgctatcatgcg
tatcctgcgcatgccgcgttcggcggttacaagcagtcgggcgtcggtcgcgagacccac
aagatgatgctcgatcattaccagcagaccaagaatctcctggtcagctacagcccgaag
aagcttggcttcttctga

DBGET integrated database retrieval system