KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_69590Help
Entry
BJ6T_69590        CDS       T01848                                 

Gene name
nrtB
Definition
(GenBank) nitrate ABC transporter permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00910  Nitrogen metabolism
bju02010  ABC transporters
Module
bju_M00438  Nitrate/nitrite transport system
bju_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BJ6T_69590 (nrtB)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BJ6T_69590 (nrtB)
Transporters [BR:bju02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    BJ6T_69590 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: BAL12208
UniProt: G7D4G7
LinkDB All DBs
Position
complement(7152770..7153666)
Genome map
AA seq 298 aa AA seqDB search
MNMPATKIEVETATLAGAAAPVVAMTPKRPPRSEAYARMARETAVRVIPPLVVIALLTLV
WELVCRRAGSALPPPSKVFKDTKELIFDPFFDHGGIDKGLFWHLSASLQRVALGYSLAAI
AGIGLGVLVGQSVWAMRGLDPLFQVLRTIPPLAWLPLSLAAFRDGQPSAIFVIFITSIWP
IIINTAVGIRNIPQDYRNVAAVVQLNPLEFFGKIMIPAAAPYIFTGLRIGIGLSWLAIIA
AEMLIGGVGIGFFIWDAWNSSHISEIILALFYVGIVGFVLDRLIAGLGKIVTRGTAQN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcctgccacgaagattgaggttgagactgcgacgcttgcgggcgctgccgcg
ccggtcgtcgcgatgacgccgaagcggccgccgcgcagcgaggcctacgcgcgtatggcg
agggagaccgccgtgcgcgtgattccgccgctggtcgtgatcgcgctgctgacactggtg
tgggagctagtctgccgccgcgccggctcggcgctgccgccgccgtcaaaggtgttcaag
gacaccaaggaattgatcttcgatccgttcttcgatcatggcggcatcgacaagggcctg
ttctggcatctctccgccagcctccagcgcgtcgcgctaggctactcgctcgccgccatc
gccggcatcgggctcggcgtgctggtcgggcagtcggtctgggcgatgcgcgggctcgat
ccgctgttccaggtgctgcgcaccatcccgccgctggcctggctgccgctgtcgctcgcg
gcgttccgcgacggccagccgtcggcgatcttcgtcatcttcatcacctcgatctggccg
atcatcatcaacaccgcggtcggtatccgcaacatcccgcaggactaccgcaacgtcgcc
gcggtggtgcagctcaatccgctcgagttcttcggcaagatcatgatcccggcggcggcg
ccctacatcttcacgggccttcgcatcggcatcggcctgtcctggctcgccatcatcgca
gccgaaatgctgatcggcggcgtcggcatcggcttcttcatctgggacgcctggaattcc
tcgcatatcagcgagatcatcctggcgctgttctatgtcggcatcgtcggcttcgtgctc
gaccgcctgatcgcgggcctcggcaagatcgtcacccgcggcacggcgcagaactga

DBGET integrated database retrieval system