KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_74000Help
Entry
BJ6T_74000        CDS       T01848                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00564  Glycerophospholipid metabolism
bju01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bju00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BJ6T_74000
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BJ6T_74000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: BAL12647
UniProt: G7D8G8
LinkDB All DBs
Position
complement(7630888..7632438)
Genome map
AA seq 516 aa AA seqDB search
MRLLERIFDLAIIGGGVNGCGIARDAVGRGNTVFLCEMNDLASGTSSWSTKLVHGGLRYL
EYYEFRLVREALIEREILWGIAPHIIRPLRFVLPHHAGLRPAWLLRLGLFLYDHIGGRHL
LPATRSVDLRRDEVGRPLIPNRYSRAFEYSDCFVDDARLVVLNARDAADKGAEIRTRTRA
TDIKQSGGIWTVGMVNTLTGERSSIQARALVNAGGPWVEDVLGRGAGVNTKAKVRLVQGS
HIVVKKLYDHDRAYMFQNADGRIIFVIPYQDDFTLIGTTDRDYDGDPAKVKATPEEIEYL
CAAASEYLAKPVTSADVVWTYSGVRPLYDDGASEAKAATRDYVFELDTPGGVPLLSIYGG
KITTYRRLAEEALERLAPYLRSAKAREGWTGKWPLPGGDMGVSDVDGLIAELQRGYPFLS
LEHARRLARAYGTRAIKLLGDAKSAADLGQAFGATLTEREVRYLMANEWAVTAEDIVWRR
SKLGLRLSADEIAALNDWIATHTVPQSPLLEAGGRP
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgttggagcgtattttcgacctcgccattatcggaggcggtgttaacggctgc
ggcatcgcgcgcgacgcggtgggccgtggcaacacggtcttcctgtgcgaaatgaacgat
ttggcgagcgggacctcgtcctggtcgaccaagctggtgcatggcggcctgcgctatctc
gaatattacgagtttcgcctggtccgcgaggcgctgatcgagcgcgagatcctctggggc
atcgcgccccatatcatccgtcccctgcgtttcgttttgccgcatcacgccggcctgcgt
ccggcctggctgctgcgcctcggcctcttcctctatgaccatatcggcggccggcacctg
ttgccggcgacgcgttcggtcgatctcaggcgcgacgaggttggccgtccgctgatcccg
aaccgctacagccgcgcgttcgaatattccgactgtttcgtcgacgacgcccgtctcgtc
gtgctcaacgcacgcgatgccgccgacaagggcgccgagatccgcacccgcacccgcgcg
acggatatcaagcagtccggcggcatctggaccgtcggcatggtcaacacgctgaccggc
gagcgctcttcgatccaggcccgcgcgctggtcaatgccggcggcccctgggtcgaggac
gtgctcggccgcggcgccggcgtcaacacgaaagccaaggtgcgcctggtgcagggctcg
cacatcgtggtcaagaaactctatgaccacgaccgcgcctacatgttccagaacgcggac
ggccgcatcatcttcgtgatcccgtaccaggacgactttacgctgatcggcaccaccgac
cgcgactacgacggcgatccagccaaggtgaaggcgacgcccgaagagatcgagtacctc
tgcgccgccgcgagcgagtatctggccaagccggtgacttcagcggacgtggtctggacc
tattccggcgtgcgaccgctctatgacgacggcgccagcgaagccaaggccgcgacgcgc
gactacgtgttcgagctcgacacacccggcggcgtgccgctgctctcgatctatggcggc
aagatcacgacctaccgccggctcgccgaagaggcgctggaacggctcgcgccctatctt
cgcagtgcgaaagcgcgcgaaggctggaccggcaaatggccgctgcccggcggcgacatg
ggcgtctccgacgtcgacggcctgatcgccgagctccagcgcggctatcccttcctcagc
ctcgagcacgcccggcgtctcgcccgcgcttacggcacccgcgccatcaagctgctcggc
gatgcgaaatcggcggccgatctcggccaggccttcggcgcgacgctgaccgagcgcgag
gtccgctacctcatggccaatgaatgggcggtcacggcggaagacatcgtctggcgccgc
tccaagcttggcctgcgactatctgccgacgagatcgctgcattgaacgactggattgca
acccacactgtgccgcaaagtcccctgctggaagcgggaggacgcccatga

DBGET integrated database retrieval system