KEGG   Bifidobacterium kashiwanohense PV20-2: AH68_01080Help
Entry
AH68_01080        CDS       T03496                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bka  Bifidobacterium kashiwanohense PV20-2
Pathway
bka00473  D-Alanine metabolism
bka00550  Peptidoglycan biosynthesis
bka01100  Metabolic pathways
bka01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bka00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AH68_01080
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AH68_01080
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AH68_01080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bka01011]
    AH68_01080
Enzymes [BR:bka01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AH68_01080
Peptidoglycan biosynthesis and degradation proteins [BR:bka01011]
 Precursor biosynthesis
  Amino acid ligase
   AH68_01080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AIZ13843
UniProt: A0A0A7I0N4
LinkDB All DBs
Position
280461..281597
Genome map
AA seq 378 aa AA seqDB search
MAKQRIVVMYGGKADEHSISCISAAGVLRALDTDKFEAIEVGITKNGEWIVDGEDPRKWN
MSEGLPTVEKTDSSKDVVLEVALGQDGFFAREDDGTLTSLGHVDAVLPVLHGPYGEDGTI
QGLFEMMNVPYVGCGVLASAACMDKHYTKVLLAAAGIPVAPGITLDVRNYDAASEFATEA
DEMLAAVQQAGLQYPLFVKPSRAGSSFGVTKVEHEGNAAELAAAVFEASHHDWRVLVEQG
VDAREIECAVLCPKAGEAPQASWPGEIVLDKRAEGDDQFYDFDSKYMNSDASHVEVPASL
PEETLNRVRETAKKAFIAVDGAGLSRVDTFVTADGEVMVNEINTMPGFTPISMYPKAWEA
TGVSYTDLITTLIEGVLR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacagcgcattgtagtgatgtatggcggcaaagccgacgagcattcgatttcc
tgcatctctgcggcgggcgtgctgcgcgcgttggatactgacaagttcgaagccattgag
gtgggaatcaccaagaacggcgagtggattgtggacggcgaggatccacgcaagtggaac
atgagcgaaggtctgccgacggtggagaagacggattcctccaaagatgtggtgctggag
gtggcactcggccaggatggtttcttcgctcgtgaagacgacggcacgctgacttcgctt
ggccacgtggacgccgtgcttccggtattgcatggtccgtacggtgaggatggcacgatt
cagggcctgttcgaaatgatgaacgtgccgtatgttggctgcggtgtgctcgcttccgcc
gcctgcatggacaaacattatacgaaggtattgctggctgcggccggtattcccgtggct
ccaggcatcacgttggatgtgcgtaattatgatgccgcttccgaattcgccaccgaggcg
gacgagatgcttgccgcggtgcagcaggccggattgcagtacccgctgttcgtgaagccg
tcccgcgccggttccagcttcggcgtgaccaaggtcgaacatgagggcaatgcggccgag
cttgccgccgcagtgttcgaagcgtcccaccatgattggcgtgtgctcgtggaacagggc
gtcgacgcgcgcgaaatcgaatgcgccgtgctctgcccgaaggccggcgaggctccgcag
gccagctggccgggcgaaatcgtgcttgacaagcgtgccgaaggcgacgaccagttctat
gatttcgacagcaagtacatgaactccgacgcaagccatgtggaagtgcccgcaagcctg
ccggaagaaactctgaaccgcgtgcgcgaaaccgccaaaaaagcgttcatcgcagtcgac
ggcgccggcctgagccgtgtcgacaccttcgtgacggccgacggcgaagtgatggtcaac
gaaatcaacaccatgccgggcttcaccccgatttccatgtatcccaaggcatgggaggcg
accggcgtgagctacaccgacctgatcaccacgctgatcgaaggcgtgctgcgctga

DBGET integrated database retrieval system