KEGG   Bacillus kochii: CKF48_00830Help
Entry
CKF48_00830       CDS       T05194                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bko  Bacillus kochii
Brite
KEGG Orthology (KO) [BR:bko00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bko01001]
    CKF48_00830
Enzymes [BR:bko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CKF48_00830
Protein kinases [BR:bko01001]
 Serine/threonine kinases: Other
  Bacterial family
   CKF48_00830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo RIO1 Kinase-like Haspin_kinase Seadorna_VP7 PIP49_C Pkinase_fungal DUF4448 FTA2 YrbL-PhoP_reg AgrB
Motif
Other DBs
NCBI-ProteinID: ASV65996
UniProt: A0A248TCV9
LinkDB All DBs
Position
complement(169170..171164)
Genome map
AA seq 664 aa AA seqDB search
MMIGKRINGRYKILEMVGGGGMANVYLAHDMILDRNVALKMLRLDFAEDDEFIKRFHREA
QSATSLTHQNIVTIYDVGEEDTLYYIVMEYVDGQTLKQYIQKNGPVPLETAIDIMKQLTS
AISHAHQNQIIHRDIKPHNILIDHEGKIKITDFGIAMALSATSITQTNSVLGSVHYLSPE
QARGGMANRKSDIYSLGIVMFELLTGRLPFSGESAVSIALKHLQSETPSLRRWNPDIPQS
VENIVLKATAKDPFHRYNSADEMEEDLSTSLNEERMNERKFTVPDDDDATKAIPIITADK
MYHPTDETIIHKIEEKNEDSPVPIVKKESPKKEKEDTKKKKKRKKGPMILISTFVLLVVL
FVLSVTVLPEMLSPDDVTVPDVSNMSVDDAKTLLQEEGFTIGEEIEQNNDEVKAGEVIRT
EPRAGRTQKEGTAVNIYESIGKERYSMEDFTGRPYSDIEELLKEEGFQSIQSEEEFSEEA
KGTILEQNIDPGEEVIPQEEELIFVVSKGEEPIELKDLTGYNDKALAEYEASSGLTIEVA
GEEHHAEIAQGEVIRQEPGAGASLNDGDTVKVYLSSGPEQVPVEVKREVNVPYKPNPDNV
GQPQEVQIFIEDMDNNIDEPFNTIHITEDRVISFSLQIQPGETASYQIMRDGQMIIQENV
PYEQ
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
ttgatgattggtaagcgtataaacggccgttataaaattttggaaatggtcggtggaggc
ggcatggccaacgtttatttagctcatgatatgattctagatcgaaacgtggcattaaag
atgttgcgtctagacttcgctgaagatgatgagtttattaaacgatttcaccgtgaagct
caatcagctacaagcctaactcaccaaaatattgtgacgatttatgatgttggagaagaa
gataccctatattacatcgtcatggaatatgttgacggtcaaacattaaaacaatacata
caaaaaaacgggcctgtccctttggaaacagcgattgatattatgaaacagctgacatca
gctatttctcacgcccatcaaaaccagattattcatcgtgatattaaaccacataatatc
ttaattgatcatgaaggcaagataaaaattactgattttggaattgcaatggctctaagt
gcaactagcattacccagacgaattccgtattagggtcggttcattatttatcaccagaa
caagcaagaggcggtatggcaaaccgtaaatcagatatatattcattagggattgtcatg
tttgagctgttaactggaagattaccgttttcaggagaatcagctgtttctattgcattg
aaacacttgcaatcagaaacgccttccttaagaagatggaacccagatataccacaaagt
gttgaaaatatcgtattgaaggcaacagcaaaggaccctttccatcgctataatagtgcc
gatgaaatggaagaagacctctctacatctttgaacgaagagaggatgaacgaaagaaag
tttactgtacctgatgacgatgatgctacaaaagcaattccgatcattactgcagataaa
atgtaccatcctactgacgaaacgattattcataaaattgaagaaaaaaatgaagatagt
cctgtacctattgtaaaaaaggaaagtccaaaaaaagaaaaagaagatacgaaaaagaag
aaaaaacgaaaaaaaggtccaatgatccttatatctacttttgttctattagttgtgcta
tttgttctttccgtcactgttttacctgagatgctttcacctgatgatgttactgtacca
gatgtatcaaatatgagcgttgatgacgcgaaaacattgttacaagaagaaggatttacg
attggtgaagaaatcgaacaaaacaatgatgaagtgaaagcaggggaagttataagaacc
gaaccgagagcagggaggacacagaaagaaggaacagcagtaaatatttatgaaagtatc
ggtaaagaacgctattcaatggaggattttactggtcgcccatatagtgatatagaagag
ttactaaaagaagagggtttccaatctatccaatcagaagaagaatttagtgaggaagca
aagggaacaattctagaacagaatattgatcccggagaagaagtgattccccaagaagaa
gagctcatctttgtcgtcagcaaaggggaggaaccgatagaattaaaagatttaaccggt
tataatgataaggccctagcagaatacgaagcatctagtggattaacaattgaagtagct
ggagaagagcatcatgctgagattgctcaaggtgaggtcattcggcaggaacctggagct
ggagcatctttaaatgacggggacacagtaaaagtttatctatcaagtgggccggaacaa
gttcctgtagaagtgaaaagagaagtgaatgtaccgtataagccaaatcctgataatgtc
ggacaacctcaagaagtacaaatctttatagaagatatggacaacaatattgatgagcca
tttaatacgattcatattactgaagatcgagttatttccttttcactgcaaatacaacca
ggagaaaccgcttcttaccaaattatgagggatggacaaatgattattcaagaaaatgtt
ccgtatgaacagtga

DBGET integrated database retrieval system