KEGG   Bacillus kochii: CKF48_04245Help
Entry
CKF48_04245       CDS       T05194                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bko  Bacillus kochii
Pathway
bko00627  Aminobenzoate degradation
bko01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bko00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CKF48_04245
Enzymes [BR:bko01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     CKF48_04245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASV66599
UniProt: A0A248TEL3
LinkDB All DBs
Position
857432..858892
Genome map
AA seq 486 aa AA seqDB search
MSFQLSVLNKQFINGEWRQGKSQTLLQNINPFNEDILAEVNGATLEDIDEAYQASAKAKL
EWDRVNPYKKRDILEKAVAIIDSHEEEIVQLIIAELGGTRLKAAFEIGLVKNMIKEAATY
PLRMEGKILPSTEDHKENRLYRVPAGVVGVISPFNFPFFLSMKSVAPALGAGCGVVLKPH
EDSMVTGGTLIGKIFEEAGVPKGLLNVVLCDIKEIGDGFVEHPIPRIISFTGSTTVGSYI
GQVAVKNFKKPLLELGGNSAFIVMEDADIDYAVNAATFSRFTHQGQICMSANRILVQKSI
YPTFMNKFKEKVAALKVGDPSDPETVIGPVINKRQASTLEDLIHTGIQEGAEPILLGEIS
GNLVAPTILTNVTPEMTVAQKELFGPVVCIMTFDTEEDAINIANNTQLGLSGALHTANVE
RGVEMAKRIHTGMIHVNDVTINDEPIVAFGGEKQSGLGRLNGDWSLDEFTTMKWISVNYS
QRQLPY
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagttttcaattatcagtattaaataagcagtttataaatggagaatggcgccaagga
aaaagtcaaactctcttacaaaatattaatccatttaatgaagacatccttgcagaagta
aatggtgctacattagaagatattgatgaagcatatcaagcaagtgctaaggcaaagcta
gaatgggatcgtgtcaacccctataaaaaacgagacatattagaaaaagcggtagccatt
atcgactcacatgaagaagaaattgtccagttaattattgctgaacttggaggtactcga
ttaaaagcggcttttgaaattggccttgtaaaaaatatgattaaagaggcagccacttac
ccacttcgtatggaaggtaaaattctgccgtctacagaagaccataaagaaaatagatta
tatcgtgttccagctggtgtggttggagtcattagtccatttaactttcctttcttcctt
tctatgaaatcagttgctcctgcacttggcgcgggatgtggagtagtcctcaaacctcat
gaagattcaatggtaactggtggtacattaataggaaagatatttgaagaagctggtgtc
cctaaaggattactaaatgttgtattatgtgatattaaggaaattggcgatggctttgta
gaacatccgattccaagaatcatttcttttaccggttctactacagtaggtagttacatc
ggtcaagtagcagtgaagaactttaaaaaacctttactagagttaggcggtaatagtgct
tttatcgtcatggaagatgcagatattgattatgccgttaatgcagcaacatttagccgt
ttcacacaccaaggacagatttgtatgtctgcgaatcgtattctcgttcaaaaatcaatt
tacccaacgtttatgaacaaatttaaagaaaaggtagcagcacttaaagtcggggatcct
agcgaccctgaaaccgttatcggtcctgttattaataaacgacaagcatcaacattagag
gatttaattcatacgggcattcaagaaggtgcagaacctatcctattaggagaaattagc
gggaatttagttgcaccaacgattttaacaaatgtgacccctgaaatgacagtcgcacaa
aaagaactctttggtcctgttgtttgtattatgacttttgatacagaagaagatgccatt
aatattgccaacaatacacaactcggattaagcggggcgcttcatactgccaatgtagaa
cgcggtgttgaaatggcaaaaagaattcacacgggtatgattcatgtaaatgatgtcacg
attaacgatgagcctattgttgcttttggtggtgaaaaacaatccggacttggtcgatta
aatggagattggagtttagatgagtttacaacaatgaaatggatttctgttaattatagt
caaagacaattgccatattaa

DBGET integrated database retrieval system