KEGG   Bacillus kochii: CKF48_06415Help
Entry
CKF48_06415       CDS       T05194                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bko  Bacillus kochii
Brite
KEGG Orthology (KO) [BR:bko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CKF48_06415
Enzymes [BR:bko01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CKF48_06415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 GIDA FAD_oxidored HI0933_like Thi4 FAD_binding_3 DAO NAD_binding_7 K_oxygenase AlaDh_PNT_C Glutaredoxin Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ASV66993
UniProt: A0A248TFN5
LinkDB All DBs
Position
complement(1277854..1279383)
Genome map
AA seq 509 aa AA seqDB search
MILEAEIKEQLHQYLQLMEGDVLLKVSTGDDDVSKDMLSLVDELATMSSKIKVEHATLKR
TPSFSVNRMGEDTGVAFAGIPLGHEFTSLVLALLQASGRAPKVDDKVMEQVKNIQGEFHF
ETYVSLTCHNCPDVVQALNIMSVLNPGITHTMIDGAAFKEEVDSKNIMAVPTVFLNGEVF
GSGRMTLDEILAKMGSTEDPAEFSNKDPFDVLVVGGGPAGASAAIYAARKGIRTGVVAER
FGGQIMDTLGIENFIGTKYTEGPKLAASLEEHVKEYDVDVMNLQRAKSLQRKELIEVELE
NGAVLKSKSVILSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVKHVTVIEFGAELRADSVLQERLYSLPNVNVIKNAQTTEITGTDKVNGITY
LDRETEEVHHIELQGIFVQIGLVPNTDWLGDTIERTRTGEIVVDNHGATNVPGVFAAGDC
TNNPYKQIIISMGSGANASLGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatattagaagcagaaattaaagagcaactccatcagtatcttcaactgatggagggc
gatgtattactgaaagtaagtaccggagacgatgacgtatcaaaagatatgctttctctc
gttgatgaacttgcaacaatgtcatctaaaattaaggtagaacatgctactttaaaaaga
acaccaagcttcagcgtgaatcgcatgggtgaagatacaggtgtagcttttgctggtatt
cctcttggtcatgaatttacttccttagtattagccttattacaagcaagtggccgcgcg
ccaaaagtagatgataaggtgatggaacaagtaaagaatattcaaggggagtttcatttc
gaaacttacgttagtttgacatgccataattgtcctgatgtggtacaagcattgaatatc
atgagtgtgttaaacccaggtattacacacacaatgattgatggcgcggcttttaaagaa
gaagtcgatagcaaaaacatcatggccgtaccaactgttttccttaatggagaagtcttt
ggtagtggacgtatgactttagatgaaattttagcgaagatgggtagcacggaagatcca
gcggaattttctaataaagatccatttgatgtactagttgttggtggtggaccagcaggt
gcgagtgcagcgatttatgctgctcgtaaaggtatccgtactggggttgttgctgagcga
ttcggtggtcaaatcatggatacgctaggaatcgagaactttatcggtacgaagtataca
gaaggtcctaagcttgcagctagtcttgaagaacatgtgaaagaatacgatgtcgacgtg
atgaatctacaacgcgcgaaaagcttacaaagaaaagaactcattgaagtggaattagaa
aacggtgcggttcttaagagtaagtcagtcattctttccacaggtgcaagatggagaaac
gttggcgtacctggtgaagcagaattcaaaaataaaggtgtcgcttactgtccacattgt
gacggcccattatttgaaggaaaagacgttgcggtcatcggtggcggtaattcaggcatt
gaggcagcaatcgacctagccggtatcgttaaacatgtaacagttattgagttcggtgca
gaactaagagcagattcggtcctacaagagcggctatatagcttaccaaatgtaaatgtg
attaaaaacgcacaaacaacagaaatcacgggtacagataaagtgaatgggatcacttat
ttagaccgtgaaacagaagaggtacaccatattgaacttcaaggaatctttgttcaaatt
ggtcttgttccaaacacggattggttaggcgatacgattgagcgcacaagaacaggcgaa
atcgtcgtcgataaccatggtgcaacaaacgtcccaggcgtatttgcagcaggtgactgt
acgaacaacccgtacaaacaaattataatttctatgggatcaggtgccaacgcatcatta
ggtgcatttgattatctgattaggaattaa

DBGET integrated database retrieval system