KEGG   Bacillus kochii: CKF48_12765Help
Entry
CKF48_12765       CDS       T05194                                 

Definition
(GenBank) peptide ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
bko  Bacillus kochii
Pathway
bko02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bko00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CKF48_12765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bko02000]
    CKF48_12765
Transporters [BR:bko02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    CKF48_12765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 AAA NB-ARC AAA_22 PRK AAA_7 TniB AAA_16 RNA_helicase AAA_5 AAA_15 NACHT AAA_29 ResIII Mg_chelatase ATP-synt_ab
Motif
Other DBs
NCBI-ProteinID: ASV68113
UniProt: A0A248TIT1
LinkDB All DBs
Position
2492372..2493385
Genome map
AA seq 337 aa AA seqDB search
MDDYLLEVENLKTVFSSERGPVTAVDGVTFKVKHGEVLGLVGESGCGKSVTAESIMRLLN
EKHTKYEGEILFNKKDLLKLTMNDMLDIRGNKISMIFQDAMTSLNPVYTIGNQIVEAIMI
HQNLNKNEANEKAIEMLRLTGIPSPEKRIYEYPHEISGGMRQRVMIAMALSCKPNLLIAD
EPTTALDVTIQAQILDVINDLKEELNMGVIMITHDLGVVAEVCTRVVVMYLGQIIEEAEV
NELFTKPLHPYTKGLLKSIPKIDGDRNERLHTIQGVVPSLSEVPKGCRFAPRCEFATERC
LGEAPLIEDYNENHKIRCWNYRDILVEEENYVPISTR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtggatgattatctattagaagtagagaatctaaaaacggtcttttcttcagagaggggt
ccagttacggcagtagacggggtcacctttaaagtgaaacatggagaggttttaggtttg
gtaggagaatctggttgtggtaaaagcgtgacagctgaatctattatgcgattacttaat
gaaaagcatacgaaatatgaaggggaaatcctcttcaataaaaaggatctcttaaagtta
actatgaacgatatgttagatatcagagggaataaaatctcaatgatctttcaggatgcg
atgacatcattaaatccagtatatacaattggaaatcaaatagtggaagctatcatgatc
caccaaaatttaaataagaatgaggctaatgagaaggcgatagaaatgttaagactcact
ggtattccttccccagaaaagaggatatatgaatatcctcatgaaatatctggggggatg
agacagagagtaatgattgcgatggctttatcttgtaagcccaatttattaattgccgac
gaaccgacgacagccttagatgttaccattcaagcccaaatactagatgtaattaatgat
ttaaaagaagagttaaatatgggtgtgattatgattactcacgatttaggtgttgtcgca
gaggtttgtacgcgtgtagtggttatgtatttagggcaaatcatcgaggaagcagaagta
aatgaattatttactaaaccccttcacccctacactaaagggttattaaagtctatccct
aaaattgatggagatagaaatgaaagattgcacacgatacaaggtgtagtgccatcttta
agtgaagtacctaaaggctgtaggttcgcaccaagatgcgaatttgcaacggaaagatgt
ttaggtgaggcaccattgatagaagattataatgaaaatcataaaatcagatgttggaat
tatcgagatattttagtagaggaggagaactatgtcccaatcagtactcgttaa

DBGET integrated database retrieval system