KEGG   Bacillus kochii: CKF48_12890Help
Entry
CKF48_12890       CDS       T05194                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
bko  Bacillus kochii
Pathway
bko02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bko00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CKF48_12890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bko02000]
    CKF48_12890
Transporters [BR:bko02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    CKF48_12890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 AAA_22 AAA_16 AAA_29 AAA DUF87 Sigma54_activat AIG1 AAA_7 ATP-synt_ab AAA_19 NACHT MMR_HSR1 G-alpha Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: ASV68137
UniProt: A0A248TIV2
LinkDB All DBs
Position
complement(2516473..2518230)
Genome map
AA seq 585 aa AA seqDB search
MEPLLKIENLQVSFMSREKEFEAVKGVSFTVNKGETLGIVGESGSGKSVTARSIMRLLPS
PPSLLKDGEIMFLGKDLVNASDQEMEAIRGKDISMIFQDPMTSLNPTMRIGQQLTETMLK
HTKGLGKTQAKAEAIELLRLVGIPKPEVRFAQYPHEFSGGMRQRAMIAIALACRPKLLIA
DEPTTALDVTIQAQILNLMKHMQEKFGTAIILITHDLGVVAGMCDRVVVMKDGEIVEKGT
TEEIFEHATHPYTLRLLNALPKLHEKKKAKPAPRISEEINAKEPLLEVKALKQHFDLGKG
QVLKAVDDISFFIKPGETLGLVGESGSGKSTTGRAILRLNEPTAGEVLYQGIPVNQLTAK
EMKMMRRHMQMIFQDPYASLNPRYKVIDIIGQALDIHKLVKNKQERRKRVEELLEMVGLE
KEHAMRYPHEFSGGQRQRIGIARALAVEPKFIVCDEPLSALDVSIQAQIVKLLEDLQQKL
GLTYLFIAHDLSMVKHISDRVAVMFGGKIVELAESEELYANPQHPYTKSLLAAIPIPDPA
IERQKKRETLSAQEERREEYQLDNAELVEVTPGHWVAQPKVTVGI
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtggaaccgttattaaaaatagaaaatttacaagtatcctttatgtctcgagagaaggaa
tttgaagctgtcaaaggtgtcagctttactgtcaataaaggagaaacattaggcattgtc
ggtgaatcaggcagtggcaagagtgtcactgcccgctcgattatgagactgctcccgtct
cctccttcccttttaaaagacggcgaaattatgtttctcggtaaagatttggtcaatgca
agtgatcaagaaatggaagcaatcagagggaaagatattagcatgatcttccaagatcca
atgacctcgttgaatccgacgatgcgtattggtcaacaattaactgaaacgatgcttaaa
catacaaaaggactaggtaaaacacaagcaaaggctgaagccattgagcttttaagatta
gtagggattccaaagccagaagttcgttttgcccaatacccacatgagttttctggcggg
atgcggcaacgggcaatgattgctatcgctcttgcttgtcgtcctaagctactcatcgct
gacgaaccaacaacagcacttgatgtaaccatacaagcgcaaatactgaacctaatgaag
catatgcaagaaaaatttggtactgcgattattttaatcacccatgaccttggcgttgtt
gctggcatgtgtgaccgtgttgtcgtaatgaaggacggggaaatcgttgaaaaaggcaca
accgaagaaatctttgagcatgccactcacccttatacattacgattactcaacgcttta
ccaaagcttcatgagaaaaagaaagcaaaaccagcaccgcgtattagtgaagagatcaat
gcaaaagaaccccttctcgaagtaaaagcattgaaacaacacttcgatttaggcaaaggc
caagtgttgaaggctgttgatgatattagcttctttattaaacctggtgaaacacttggt
cttgtcggagagtctggttcaggaaagtccaccaccgggcgtgcgattttaagattaaat
gaaccaactgctggtgaagtgttgtaccagggtattcctgtgaatcaactaacagcaaag
gaaatgaagatgatgcgcagacatatgcaaatgatttttcaagatccttatgcttcatta
aatccgcgctataaagtaattgatatcatcggtcaagcactagatattcataagctcgta
aaaaataagcaagaacgccggaaacgcgtagaagagttactagaaatggtgggtttggag
aaggaacatgcaatgcgttatccccatgaattttcagggggacaaagacagcgaattggg
attgcccgcgcacttgccgtcgaaccaaaattcatcgtctgtgatgaaccactctctgca
ctagacgtatccatccaagcgcaaatcgttaaattacttgaagacttacagcaaaagctt
ggattgacttacctatttattgcccacgacctctccatggttaaacatattagtgaccgt
gtagccgtcatgttcgggggaaaaatcgtcgaactcgcagaaagtgaagaactctatgct
aacccgcagcacccatatacaaaatcgctactcgctgccatcccaatccctgacccagcg
attgaacggcagaaaaaacgcgaaactttgtccgcacaagaagagcgacgtgaggaatat
caactcgataatgctgaacttgtggaagtaacgcctgggcattgggttgctcagccgaag
gtaacagtgggaatataa

DBGET integrated database retrieval system