KEGG   Bacillus kochii: CKF48_16490Help
Entry
CKF48_16490       CDS       T05194                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bko  Bacillus kochii
Pathway
bko00020  Citrate cycle (TCA cycle)
bko00480  Glutathione metabolism
bko01100  Metabolic pathways
bko01110  Biosynthesis of secondary metabolites
bko01120  Microbial metabolism in diverse environments
bko01130  Biosynthesis of antibiotics
bko01200  Carbon metabolism
bko01210  2-Oxocarboxylic acid metabolism
bko01230  Biosynthesis of amino acids
Module
bko_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bko_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKF48_16490
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CKF48_16490
Enzymes [BR:bko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CKF48_16490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ASV68743
UniProt: A0A248TKK8
LinkDB All DBs
Position
3229999..3231267
Genome map
AA seq 422 aa AA seqDB search
MAAEKITVNNGVLNVPNEPIVPFIEGDGTGPDIWASASRVLDAAVEKAYKGERKIAWKEV
LAGEKAFNQTGEWLPKETLDVINEYLIAIKGPLTTPIGGGIRSLNVALRQELDLFVCLRP
VRWFEGVPSPVKRPQDTDMVIFRENTEDIYAGIEYAKGTDEVNKLISFLKDEMGVNKIRF
PETSGIGIKPVSQEGTTRLVRSAIDYAINEGRKSVTLVHKGNIMKFTEGAFKNWGYELAE
KEYGDKVFTWAEYDRIKDESGVDAANKAQADAEAAGKIIVKDAIADIFLQQILTRPAEFD
VVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPSS
VILSGVLLLKHLGWNEAADLIEKSMEKSIASKVVTYDFARLMDGATEVKCSEFGDVLIKN
MD
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagaaaaaattacagtaaataatggtgttttaaatgtaccaaatgaaccaatc
gttccttttatcgaaggtgacggaactgggccggatatttgggcatctgcttctcgtgtt
ttagatgcagcggttgaaaaagcatataaaggtgagcgtaaaattgcttggaaagaagtt
ttagctggtgaaaaagcatttaaccaaacaggcgaatggttaccaaaagaaactttagat
gtaattaatgaatacttaatcgccattaaaggaccacttacaacaccaattggtggagga
attcgttctttaaatgttgcattgcgtcaagaattagatcttttcgtatgcttgcgtcca
gtacgctggtttgaaggtgttccttcaccagttaagcgcccacaagatactgacatggtc
attttccgtgaaaatactgaagatatctatgcaggtattgaatatgctaaaggtacagat
gaagtaaacaaattaatctctttcttaaaagatgaaatgggtgtcaataaaattcgtttc
ccagaaacatctggaatcggtattaaacctgtttctcaagagggaacaactcgtctagtt
cgctctgcaattgactatgcaatcaacgaaggtcgtaaatcagtaacacttgtacacaaa
ggtaatatcatgaaatttactgaaggtgcatttaaaaattggggttacgaactagctgaa
aaagaatacggcgataaagtattcacatgggctgaatatgaccgcattaaagatgaaagt
ggcgtagatgcagcaaacaaagcgcaagctgatgctgaagctgctggtaaaatcatcgtt
aaagatgcaattgctgatatcttcttacaacaaatcttaactcgtccagcggaatttgat
gtagtagcaacaatgaaccttaacggtgactacatttctgatgcgttagcagcacaagtt
ggtggaatcggtattgctccaggagcaaacatcaactacgaaactggacatgcgattttc
gaagctacacacggaacagctcctaaatatgcaggtttagacaaagtaaacccttcatct
gttattctttcaggtgtgcttttacttaaacatttaggctggaatgaagcggctgactta
attgaaaaatctatggaaaaatctattgcttctaaagttgtaacttatgactttgctcgt
ctaatggacggagctactgaagtgaaatgttctgaattcggtgacgtcctaatcaaaaac
atggactaa

DBGET integrated database retrieval system