KEGG   Bacillus kochii: CKF48_18660Help
Entry
CKF48_18660       CDS       T05194                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bko  Bacillus kochii
Brite
Enzymes [BR:bko01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CKF48_18660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Nitrate_red_del
Motif
Other DBs
NCBI-ProteinID: ASV70090
UniProt: A0A248TPR0
LinkDB All DBs
Position
3658225..3659106
Genome map
AA seq 293 aa AA seqDB search
MNEYLKNVFQWNEDMRAFLESENIEESNELWDKLDHMTAIMETIDHSMGDKEIEEIHEKV
EELHGEMEQYFNHRLSLGQIYVNEVSVQAGKHELPPLPYGYNALEPYISEEIMRLHHDKH
HKSYVDGLNKAEKELEKARNSGDFSLVKHWSRELAFNGSGHYLHTIFWGNMSPQGGGEPT
GELKKEIVKYFGSFEAFKKHFTEAAKQVEGSGWTILVWSPRARHLEVLQSEKHQNLTQWD
TIPLLVLDVWEHAYYLQYKNDKGAYIDSWWNIVNWDNVSRRFQKAHEMKWQPF
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaatacttaaagaatgtgtttcaatggaatgaagatatgagggcttttttggag
agtgaaaatattgaagagagcaatgagctatgggataaacttgatcatatgacagccatt
atggagacaattgatcatagtatgggagacaaggaaatagaagaaattcacgaaaaagta
gaagaacttcacggtgagatggaacagtatttcaatcaccgattatcacttggacaaatt
tatgttaatgaagtaagtgttcaagctggaaagcatgaacttccacctttaccttatgga
tataatgctttagaaccgtatatctcagaagaaatcatgagattacatcatgataagcat
cacaaaagttatgtggatggactgaataaagcagaaaaagaattagaaaaggcgagaaat
tcgggcgatttttctctagttaaacattggtcaagagaattggcttttaatggatcaggc
cattatttgcatacgatattttggggaaatatgagtccgcaaggtggtggagaacctacg
ggggaattgaaaaaagaaatagtcaaatactttggtagctttgaagcttttaaaaaacat
tttacagaagcggcaaagcaagtagaaggttcaggttggactattcttgtttggtctccg
agagctagacatttagaagtattacaatctgaaaaacatcaaaacttaacacaatgggac
acgatcccgttacttgtgttagatgtttgggagcatgcctattatttacaatataaaaat
gacaaaggtgcttatattgacagttggtggaatattgtaaactgggacaatgtttcaaga
aggtttcaaaaagcacatgaaatgaaatggcagcctttttaa

DBGET integrated database retrieval system