KEGG   Bacillus kochii: CKF48_19955Help
Entry
CKF48_19955       CDS       T05194                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bko  Bacillus kochii
Pathway
bko00564  Glycerophospholipid metabolism
bko01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CKF48_19955
Enzymes [BR:bko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CKF48_19955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_oxidored NAD_binding_8 3HCDH_N Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: ASV69386
UniProt: A0A248TMF4
LinkDB All DBs
Position
3914807..3916453
Genome map
AA seq 548 aa AA seqDB search
MKFSVKNRSTTIQHLTNNEYDLVVIGGGITGAGIALDAVTRGMKVALIEMQDFAAGTSSR
STKLVHGGLRYLKQLEFHVVSEVGKERAIVYENGPHITKPEWMVLPFYQKGTFGKFTTSI
GLKVYDFLAGVKRDERREMLNKEEVLIKEPLLKEEGLLGGGHYVEYRTDDARLTIEVMKE
AAHRGADVINYAKVTDFVYRDGTIIGVEVQDQLSNESFQVFGKKCVNATGPWVEQLLDKD
EQMKNKSLKLTKGVHIVIDHSIFPLEQAIYFDSEDGRMIFAIPREGKTYVGTTDTFYKGD
PVHPSITDEDRQYLLNAIKGIFPNVKVTEADIESSWSGVRPLIHEEGKSPSEISRKDEIW
VSEHGLITIAGGKLTGYRKMAETIVDKVSFMLKEEYQLLFSKSMTKHLPLSGGRVGGAKY
FPTFIESKKQEGIKAGLNGEESLYLLRRYGSNAPVLFSLVKQYHKGEHLIPRVLWLELKY
AIEYEMVVSPVDFFFRRTGALLFNIKCVFTYKKAIIEIMEDELDWTVEQTRSYTNELNEV
IKWATNKG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttctgtgaaaaatcgttctactaccattcagcatttaactaacaatgagtat
gatctcgttgttatcggtggaggtattacaggagctggaattgcccttgatgctgtgaca
agagggatgaaagtagctttaattgaaatgcaggactttgctgcaggaacgtcaagtcgc
tcaactaaacttgtgcatggtggtctacgttatttaaaacaattagaatttcatgtcgtt
tctgaagtaggaaaagaacgggcgattgtgtatgaaaacggccctcatattacaaaacca
gaatggatggtcttacctttttatcaaaaaggaactttcgggaagttcacaacatcaatt
gggttgaaggtctatgatttccttgcgggagttaaaagagatgaaagaagagaaatgtta
aataaagaagaggtgctaataaaagaaccattattgaaagaagaaggtttacttggtggt
ggtcattatgtggaataccggactgatgatgcacggttaactattgaagtgatgaaagaa
gccgctcatcgaggagcagatgtgattaattatgctaaagtaactgattttgtttatagg
gatggaacgattattggtgttgaggtgcaagaccaactaagtaatgagtcttttcaagtt
ttcggaaaaaaatgcgtgaatgcaaccggtccttgggtggaacagcttttagataaagat
gagcaaatgaaaaataaatctttaaaactaacaaaaggtgttcatattgtcatcgatcat
tctattttcccattagagcaagctatttactttgacagtgaagatggtcgaatgattttt
gctattccaagggaagggaaaacctatgttggaacgaccgataccttttataaaggtgat
cctgtgcatccttcgataacagatgaagataggcaatatttactgaacgcaattaaaggg
atttttccaaacgtgaaggtgacagaagcagatatcgaatctagttggtcaggtgtgcgt
ccacttattcatgaagaaggaaagtcaccgtcagaaatttcgagaaaagatgaaatctgg
gtgtcagagcacggtttaattacgattgctggtggtaaattaacaggttaccggaaaatg
gccgagacaattgtagacaaagtttcgtttatgttaaaagaagaatatcaactattgttt
tcaaaaagtatgacaaaacatctaccgttgtcaggtggaagagtaggcggagcaaaatat
ttccctacttttattgaatcaaagaaacaggaagggataaaagctggattaaatggagaa
gagtctctttatctcttaaggcgttacggttcaaatgcgccggttttattctctttggtt
aagcaatatcataaaggagagcatctaatcccacgagtcttatggttagagctaaaatat
gcaattgaatatgaaatggttgtttcgcctgtagacttttttttccgccggacaggcgca
ttgttgtttaacattaagtgtgtgttcacatataaaaaggctatcattgagatcatggaa
gatgagcttgactggacagttgaacaaacacgatcatatacgaacgaactaaatgaagta
attaaatgggcgacaaacaaagggtga

DBGET integrated database retrieval system