KEGG   Bacillus kochii: CKF48_20975Help
Entry
CKF48_20975       CDS       T05194                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bko  Bacillus kochii
Pathway
bko00020  Citrate cycle (TCA cycle)
bko00310  Lysine degradation
bko00380  Tryptophan metabolism
bko01100  Metabolic pathways
bko01110  Biosynthesis of secondary metabolites
bko01120  Microbial metabolism in diverse environments
bko01130  Biosynthesis of antibiotics
bko01200  Carbon metabolism
Module
bko_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bko_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bko00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKF48_20975
  Amino acid metabolism
   00310 Lysine degradation
    CKF48_20975
   00380 Tryptophan metabolism
    CKF48_20975
Enzymes [BR:bko01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CKF48_20975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ASV69564
UniProt: A0A248TMW1
LinkDB All DBs
Position
4148378..4151212
Genome map
AA seq 944 aa AA seqDB search
MKKPSEGSGPLEQSFYGPNLGYVIELYEMYLENPESVDQEMREYFEVNGSPLQQTGVAPV
SLGAESTGVSPAQIEKTLSAIRLADFIRSNGHKAADIYPLVNREEKNVAIFDLSNYGLTE
ADLRAIPAHLICTDANIPLRDGLEAFEYLKNAYMDTLAFEFTHVDNLEEKDWLRRKVETN
SLKLNLQKPEKAKVYKRLTEVEEFEKFLHRTFVGQKRFSIEGLDTMVPMLDEIVSGSVAN
GTKTINIGMAHRGRLNVLAHVLGKPYEMIFAEFQHAPNKDLVPSEGSIGISYGWTGDVKY
HLGLDKQIKAENTTVANLTLANNPSHLEFVGPVVEGYTRAAQDKRTTGGFPEVNYDEALS
IIIHGDAAFPGQGVVAETLNLGQLNGYNTGGSIHIIANNTIGFTTESYDSRSTRYASDLA
KGYEVPIVHVNADDPEAVINAAKLAIEYRDKFHKDFLIDLIGYRRFGHNEMDEPMTTNPA
MYNIIHKRPTIKELYGEKLKKDQYLSEEEVTAIHSEVAEKLQQAYDKVPDKQEDATELNP
PETVENGIPSIQTAVPLESLQQLNEELLKWPEEYKVFRKLSKILQRRKNGLEEVGKIDWG
HAETLAFASIISDGTPVRLTGQDSERGTFAHRNIMLHDEVTGKSFSPLHQISTAKASFAV
HNSPLSEMAVLGFEYGYNVSAPETLVLWEAQFGDFANSAQVMFDQFISAGRAKWGQKSGL
VMLLPHGYEGQGPEHSSARLERFLQLAAENNWTVANLSSAAQYFHILRRQAAILNQEEVR
PLVIMSPKSLLRNPTVAATAKDLSEGQFNSILEQSGLGEKKEQVKRIVFTSGKMAIDLED
KLKDIEDKEWFHIVRVEEIYPFPFADITEVVKRYPNLEEMIWVQEEPKNMGAWNFVEPRL
KHIAPDGVEVNYIGRRRRSSTAEGDPVVHKKEQQRIIEESLTRK
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagccttcagagggtagcggacctttagaacaaagtttttatggtcctaacctt
ggctatgtaatcgagctttatgagatgtatttagaaaatccagaatcagttgaccaagaa
atgagagagtattttgaggttaatggttcaccattgcaacaaacaggggtagctcctgta
agtttaggagcagaaagcactggcgtaagtccagcacaaattgaaaaaactttatcagct
attcgtcttgccgattttattcgttcaaacggacataaagctgctgatatttatccccta
gttaatagggaagaaaagaatgttgctatttttgatttaagtaattatggattaacagaa
gcagatttacgtgcaataccagctcatcttatatgtacagatgcgaatattccgttaaga
gatggattagaagcatttgaatacttaaaaaatgcttatatggatacgttagcatttgag
ttcactcatgttgacaatttagaagaaaaggattggcttcgtcgcaaggttgaaacaaat
agccttaaacttaacttgcaaaaacctgaaaaagcgaaagtgtacaaaagattaacggaa
gtagaagagtttgaaaaattcttacaccgtactttcgtcggtcaaaaacgcttctctatt
gaaggtttagatacgatggtaccaatgttagatgaaattgtatcaggttcagtggcgaat
ggcacaaaaacaataaatattggaatggcacaccgcggacgtttaaatgtgcttgctcat
gtacttggtaagccttatgagatgatattcgcggaatttcagcatgcgccaaacaaagat
cttgtcccatctgaaggttctattggtatcagctatggatggacaggcgatgtaaaatac
catctgggattagacaaacaaatcaaggctgaaaatacaacagttgcaaacttaacactt
gcgaacaacccaagccatttagagttcgttggtcctgtagttgaaggatatacaagagcg
gctcaagataaacgtactactggtggtttcccagaagttaattacgacgaagcactttcc
atcattattcacggagacgctgcttttccagggcaaggtgttgtcgctgaaacattaaat
ctaggtcaattaaatggctataatactggtggttccatccatattattgctaataacacg
attggctttacaacagaatcttatgattctagatcgactagatatgcaagtgatttagcc
aaaggctatgaggttccaatcgtgcatgtaaatgcagatgatcccgaagcagtcatcaat
gccgctaaattagctattgaatatagagataaattccataaagatttcttaattgactta
attgggtatcgccgctttggtcacaatgaaatggacgagccgatgaccacaaacccagcg
atgtataatattatccataaaagaccaacgattaaagagctttatggtgagaaattaaaa
aaagatcaatacttatcagaagaagaggttactgctattcattcggaagtagctgaaaaa
cttcagcaagcttacgataaagtgccggataaacaagaagatgcaactgaattaaatcca
cctgagacagtggaaaatggtataccaagcattcagactgctgtgccattagagtcttta
cagcaattgaatgaagaacttctaaaatggccggaagaatataaagtctttagaaagcta
agtaaaatattacaacgtcgtaaaaatggactagaagaggttgggaaaattgattggggt
cacgctgaaacattagcattcgcttcaattatttcagatggtacgccggtaagacttaca
ggtcaagattcagagcgtggaacatttgcccatagaaatatcatgttacatgatgaagtg
acaggtaaatcgttctcacctttacatcaaatctcaacagctaaagcttcatttgctgtt
cataatagcccgttgtcagaaatggctgttctaggctttgaatatggttataatgtgtca
gctccagaaactttagttctttgggaagcacagtttggtgactttgcgaactctgcacaa
gttatgtttgatcaattcatttctgctggtcgcgcgaaatggggacaaaaatctggtcta
gtaatgcttcttccacatggatatgaaggacaaggtccagagcattcaagtgcaagatta
gaaagattcctgcagctggcagctgaaaacaattggacagtagctaacctttcttcagca
gcacagtacttccatattttaagaagacaagcagcgattttgaatcaggaagaagtaaga
ccattggtcataatgtcacctaagagtcttttacgtaaccctacagttgctgcaactgct
aaagatttatcagaaggacagtttaactcgattctcgagcaatctggccttggtgagaaa
aaagagcaagtgaaaagaattgttttcacatcaggaaaaatggctattgatttagaagat
aaattaaaagatattgaagataaagagtggttccatattgtacgtgtagaagagatttat
ccgttcccatttgctgacattactgaagtagtaaaacgttatccaaatcttgaagaaatg
atctgggtgcaagaggaaccgaagaatatgggcgcatggaattttgttgaaccaaggtta
aaacatattgcccctgacggagtagaggtaaattatatcggtagacgccgccgctcaagc
acagcagaaggcgatccagtcgtgcataaaaaagagcagcagagaattattgaagaatct
ttaacacgtaagtaa

DBGET integrated database retrieval system