KEGG   Bifidobacterium kashiwanohense JCM 15439 = DSM 21854: BBKW_0075Help
Entry
BBKW_0075         CDS       T04223                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bks  Bifidobacterium kashiwanohense JCM 15439 = DSM 21854
Pathway
bks00500  Starch and sucrose metabolism
bks01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bks00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BBKW_0075
Enzymes [BR:bks01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BBKW_0075
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BBKW_0075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: BAQ28210
UniProt: A0A087AXC8
LinkDB All DBs
Position
complement(100137..101708)
Genome map
AA seq 523 aa AA seqDB search
MASWLNNAIFYEVYPQSFNDTNSDGIGDFQGIINKLDYISNLGCNAIWINPCFDSSVYDA
GYDVRDYYATAERYGTNEDLHRLFDRAHEFDMHVLLDLVPGHTAIDNPWFLESGKGTRNA
WTDRYIWRPMTQSPNLNSPYESIRGFLGGIAERPDAAAVNCFSTQACLNYGFGTVTEDWQ
FAADSPEAQEGRLLIQNIMDFWLGLGADGFRVDMAGSLVKEDPDYYWTKQLWRQVRAHLD
ETHPDAVLVSEWGDPVNALHSGFDMDFLLHFGPSHYLDLFRENPYFSASANGDIKAFVDT
YQAMLADTKGLGYICVPSGNHDMIRMRDTLTPGEMKLAFAFLLTLPGCPFIYYGDEIGMR
YEHGLLSKEGGYERTGSRTPMQWNRNTNAGFSAAHSGDLYLPIDPSDDRPDVASQEGDAA
SLLETVRSFNTLRLAHPALQADGAIVFLHAEDHAHPLVYARSAGDERIVIAINTSDADAS
CTLPDDYADRLAHADVLLAIGDAAARCDGTLLHTPAGSATIFG
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctggctcaacaatgcgattttctacgaggtttatccgcagtcgttcaacgat
acgaacagtgacggcatcggcgatttccaaggcatcatcaacaaactcgactacatcagc
aacctcggctgcaacgcaatctggatcaacccctgtttcgactcatcggtctacgatgcc
ggctacgacgtacgcgactactacgccaccgcagaacgctacggcaccaacgaagacctg
caccgactgttcgaccgcgcacatgaattcgacatgcacgtattgctcgacctggtgcca
gggcacaccgcaatcgacaatccatggttcctggaatccggcaaaggcacgcgcaacgca
tggaccgaccgctatatctggcgtccgatgacacaatcgccgaacctgaattcgccatat
gaatcaatccgaggcttccttggcggcatcgcggaacgccccgatgccgcggctgtcaac
tgcttctccacgcaagcgtgcctcaactacggattcggaaccgtcaccgaagactggcag
ttcgccgccgactcacccgaagcgcaagagggacgcctgctcatccaaaacatcatggat
ttctggctcggactgggcgcggacggtttccgcgtagacatggccggcagcctcgtcaag
gaagatcccgactattattggaccaaacagctgtggcgtcaggtgcgcgcgcacctggac
gaaacccaccccgatgccgtgctggtctcggaatggggcgatccagtcaatgcgctgcac
tccggattcgacatggatttcctcctacatttcggcccctcgcactacctcgacctgttt
cgagagaacccgtatttctccgcctccgccaacggtgacatcaaggcgttcgtagacacg
tatcaggccatgctcgccgacaccaaaggactgggatacatctgcgtgccgtcgggcaac
catgacatgatccgcatgcgcgacactctcaccccgggcgagatgaaactcgccttcgcg
ttcctgctgaccctgcccggttgcccgttcatctactacggcgacgaaatcggcatgcgc
tacgagcacgggctgctgtcgaaggaaggcggctacgaacgtaccggatcccgcacgccg
atgcagtggaatcgcaataccaacgccggtttctcggcggcgcacagcggagacctgtat
ctgccgatcgacccctccgacgaccgtccggacgtggcttcgcaggaaggcgacgcagcg
tcgctgctagaaacggtacggtcgttcaacaccttgcggctggctcatcccgcgctgcag
gccgacggagcaatcgtattcctacatgccgaggaccatgcccacccactggtatacgcg
cgcagcgcaggcgacgagcgaatcgtaatcgccatcaatacgtccgacgccgacgcaagc
tgcacgctgcccgacgattacgcggaccggcttgcgcacgccgacgtcctgctggcgatt
ggcgacgcggcggcccgctgcgatggcaccttgctgcatacgcccgccggcagcgcgacg
atattcggataa

DBGET integrated database retrieval system