KEGG   Bifidobacterium kashiwanohense JCM 15439 = DSM 21854: BBKW_1327Help
Entry
BBKW_1327         CDS       T04223                                 

Definition
(GenBank) putative serine-threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bks  Bifidobacterium kashiwanohense JCM 15439 = DSM 21854
Brite
KEGG Orthology (KO) [BR:bks00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bks01001]
    BBKW_1327
Enzymes [BR:bks01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BBKW_1327
Protein kinases [BR:bks01001]
 Serine/threonine kinases: Other
  Bacterial family
   BBKW_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like RIO1 Kdo ABC1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: BAQ29462
LinkDB All DBs
Position
1542606..1544837
Genome map
AA seq 743 aa AA seqDB search
MKKEPQQSTMSEAPHAPEGQVIEGRYRVVSRIADGGMATVYQAVDERLGRTVAIKIMHTQ
LAQGPHRDQFVERFHREARSAAAIANPHIVQVYDTGEFDGLDYLVMEYVHGVNLRYEMNQ
QGTFSVRETLRIIGETLDGLASAHRAGVVHRDIKPENILLNDRGHVQITDFGLAKTVSQA
TLSSTGILLGTAAYLAPEMIEENQATPQGDLYSVGIMAWEMLAGKVPFTSDNPVTLVFKH
VHEDVPSIVTVCEGINANVAAFIAHLTARAVEARPADASAALAELQQLQSMLAVSDWQYQ
LPAANVNISPNTTQAEDVAVPMNEVNPAPPAPPTPSTQQFDDRTRKLDRVKPNMTTVMPV
QQQNVDPEATTRFSLPPDGAVNTADGGTLPQSPAMQNGDYGNAGKNKSSKKHRTPLIVAG
VATLLLACGAGGWAWWYYQGPGSYWTMPQPDGMSCSDSVACPITGVKWSDYESLLKVSDV
EYEVSEEYSDSVAEGDIISTDPANVGDRGSKRRGQKVRVVVSKGVRQATVPADILDATSA
SGKDPINALKKAGFDSIEQTAASDDTYSMEVPQGALLSLSVDPGATLPHNTTITVTVSQG
PKPVTMPDIVGKTKDEAKQAMDDLKLTANWTESFDDKIPQGQVISTSVNNGNTLHWGDSV
DVVVSKGPETITLPNYVGQKASDAKAALEKLGFTVKVSSQLTLDASQDKKVASQDPVGGT
EVRIRDENGTPTTITLKMYSSLF
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaggaaccgcagcaatcaaccatgagtgaagctccacacgcccccgaaggtcag
gtcatcgaaggccggtatcgggtcgtcagcagaatcgccgatggcggcatggccacggtg
taccaggcggtagacgagcgcttggggcgcacggtcgccatcaaaatcatgcatacgcag
ctggctcaggggccgcaccgtgaccaattcgtggagcgcttccaccgcgaggcacgctcc
gcggccgccatcgccaacccgcatatcgtgcaagtgtatgacaccggggaattcgacggt
cttgactacctcgtcatggagtatgttcacggcgtgaatctacgctacgaaatgaatcag
caaggcacgttcagcgttcgtgaaacgttgcgtatcatcggcgaaacgttggatggactt
gcttccgcacaccgtgcgggcgtggtacaccgcgacatcaagccggagaacattctgctc
aacgaccgcggccatgtgcagatcaccgatttcggtttggccaaaacggtttcacaagca
acgctttcctccactggcatcctgcttggaacggccgcatatctggcgccggaaatgatt
gaggagaaccaagccacgcctcaaggcgacttgtactccgtaggcatcatggcttgggaa
atgctcgcaggcaaagtgccgttcacttcggacaatccggtgacgttggtattcaagcat
gttcacgaggatgtgccaagcatcgttaccgtctgtgagggcatcaatgccaatgtggct
gcattcatcgctcacctcacggcgcgcgcagtcgaagcacgacccgcagacgcttccgcc
gcattggccgagttgcagcaactgcaatccatgctcgcggtcagcgattggcagtatcag
cttcccgcggcaaacgtcaatatatcgcccaataccacacaagcggaagatgtcgccgtc
ccgatgaatgaggttaatccggccccacccgctcccccgaccccatcgacgcaacaattc
gacgatcgcacacgcaaactggacagggtcaaaccgaacatgacgaccgtcatgccggtg
caacagcagaacgttgatcccgaggcgacaacgcgcttctctctgccgccggacggagcc
gtcaataccgcagacggcggtacattgccgcaatcccctgccatgcagaacggcgattac
ggcaatgctggaaagaacaaatcttcgaaaaagcatcgtacgccgcttatcgtcgcaggc
gtggctacgcttcttctggcgtgtggcgcaggcggctgggcatggtggtattaccagggg
cctggcagttattggaccatgcctcagcctgatggcatgtcgtgcagcgattccgtagcc
tgccccatcaccggcgtgaaatggagcgactatgaaagtctgctgaaggtttccgatgtc
gaatacgaagtgtcggaagagtatagcgattccgtggcggaaggcgatatcatctccacc
gatccggcgaatgtcggcgatcgtggcagcaagcgtcgcggccagaaagtcagggtcgtg
gtgtccaagggagtcaggcaggcgacggttcccgccgacattctcgacgcaaccagcgca
tccggtaaggatccgatcaatgcgttgaagaaggccggattcgatagtatcgaacagacc
gctgcctccgatgacacgtattccatggaggtgccgcagggggcactgctgtcgttaagc
gtggatcccggtgctacattgccacataatacgacgatcaccgtcaccgtgtcgcaggga
ccaaaaccagtaaccatgcctgatatcgtcggcaagacgaaggatgaggcgaagcaggcg
atggacgatctcaagctcaccgccaattggacggaatccttcgacgataagattccgcaa
ggtcaggtgatttccacttccgtcaacaacggcaatacgctgcattggggagatagcgtc
gatgtagtggtctccaagggaccggaaaccataaccttaccgaattatgtgggtcaaaaa
gcctccgacgccaaagctgcgttggagaagcttggattcacggtcaaagtgagttcgcag
ctcacattggacgccagccaagataagaaggtcgcttcgcaggatccggtaggtggcacc
gaagtacgtatccgagacgaaaatggaaccccgaccactattacattgaaaatgtattct
tcactgttctaa

DBGET integrated database retrieval system