KEGG   Bacillus krulwichiae: BkAM31D_01305Help
Entry
BkAM31D_01305     CDS       T04947                                 

Gene name
alr_1
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bkw  Bacillus krulwichiae
Pathway
bkw00473  D-Alanine metabolism
bkw01100  Metabolic pathways
bkw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bkw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BkAM31D_01305 (alr_1)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BkAM31D_01305 (alr_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bkw01011]
    BkAM31D_01305 (alr_1)
Enzymes [BR:bkw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BkAM31D_01305 (alr_1)
Peptidoglycan biosynthesis and degradation proteins [BR:bkw01011]
 Precursor biosynthesis
  Racemase
   BkAM31D_01305 (alr_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ARK28610
UniProt: A0A1X9M7M3
LinkDB All DBs
Position
232085..233218
Genome map
AA seq 377 aa AA seqDB search
MSQEFYRDTWAEVDLTAIADNVQAICQLYRDRDVSVIAVVKANGYGHGAVEVAKTALKSG
ASYLAVALLDEAIALREANIKAPILVLGRIRPQDVSIAQRYQVMVTVFQQQWLEEAKKFL
VTDASISIHLKFDTGMGRIGLRTKEETDAVCDFLAANKQFHVHGIFTHFATADEKDASYV
NEQHNRFVEMLDWVKEKGIQASFIHSGNSAAGMRFPEKAFNAFRLGISMYGLTPSPEITE
ELPIQLKQAFSLKSRLVHVKKVAAGEAISYGATYRAKSDEWIGTIPIGYADGWLRYHSTS
GGEVLVNGERAPFVGRICMDQCMVRLSEPVEVGTIVTLIGKDGDNRITMDEIAKRLNTIN
YEIPCVIGQRVPRVYMD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagagttttaccgagatacatgggctgaagttgatttaacggctattgccgat
aatgtacaagccatttgtcaactttaccgtgatagagatgtcagtgtgatagctgttgta
aaagcgaatggttatggtcatggtgctgttgaagtggcaaagacagctttaaaatcagga
gctagttatttagctgttgcattattggatgaagccattgctttaagagaggcaaatatt
aaggcgcctattcttgttttaggtagaattagacctcaggatgtctctattgcgcaacgg
tatcaagtgatggttacagtttttcaacagcagtggttagaagaagcgaagaagttcctt
gtgactgatgcatccatttcgatccacttgaaatttgatacgggtatgggcaggattggg
ctgagaacaaaggaagaaacggatgcggtatgcgacttcctagctgcaaataaacaattt
catgtacatgggatctttactcattttgctactgctgatgaaaaagatgcttcgtatgta
aatgaacagcacaatcgatttgttgagatgttagattgggtaaaggaaaagggcattcaa
gcttctttcattcatagtggaaacagcgctgccggtatgagatttcctgaaaaagcattt
aatgcttttcgtttaggtatttcaatgtatgggttaactccatcacctgaaattacagaa
gagcttcctatccaattaaagcaagcattttcacttaaaagccgtctcgtgcatgtgaaa
aaggttgcggcaggagaagcgattagttatggtgcgacatatcgtgctaaatcagacgaa
tggattggaacaattccgatcggttatgcagatggttggttaaggtatcatagtactagt
ggcggagaagtacttgttaatggagaacgagctccgtttgtcggtcgtatttgcatggac
caatgtatggtgcgcttatcggaaccggttgaagtcggtacaattgtgacattgattggt
aaagatggagataatagaataacaatggatgaaattgcaaaaagattaaatacgattaac
tatgaaattccttgtgtaattgggcaaagagtaccaagggtttatatggactaa

DBGET integrated database retrieval system