KEGG   Bacillus krulwichiae: BkAM31D_18655Help
Entry
BkAM31D_18655     CDS       T04947                                 

Gene name
icd_2
Definition
(GenBank) Isocitrate dehydrogenase, NADP
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bkw  Bacillus krulwichiae
Pathway
bkw00020  Citrate cycle (TCA cycle)
bkw00480  Glutathione metabolism
bkw01100  Metabolic pathways
bkw01110  Biosynthesis of secondary metabolites
bkw01120  Microbial metabolism in diverse environments
bkw01130  Biosynthesis of antibiotics
bkw01200  Carbon metabolism
bkw01210  2-Oxocarboxylic acid metabolism
bkw01230  Biosynthesis of amino acids
Module
bkw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bkw_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bkw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BkAM31D_18655 (icd_2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BkAM31D_18655 (icd_2)
Enzymes [BR:bkw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BkAM31D_18655 (icd_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ARK31698
UniProt: A0A1X9ME31
LinkDB All DBs
Position
complement(3395662..3396930)
Genome map
AA seq 422 aa AA seqDB search
MANGQVIKVNNGVLDVPNNPVVPFIEGDGIGPDIWAAASRVIDAAVEKAYNGEKKIEWKE
ILAGEKAYNQTGEWLPAETLDAVREYLIAIKGPLTTPIGGGIRSLNVALRQELDLYVCLR
PVRYFDGVPSPVKRPEDTDMVIFRENSEDIYAGIEYKEGSDEVKKLIAFLQNEMGVSKIR
FPETSGIGIKPVSQEGTDRLVRAAIQYAIDEGRKSVTLVHKGNIMKFTEGAFKNWGYEVA
EREFGDKVFTWAQYDKIVEAEGKEAANKAQADAEAEGKIIVKDSIADIFLQQILTRPKEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYDTGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGELMLRHLGWNEAADLIMASMDKTIASKVVTYDFARLMEGATEVSCSGFAEELIK
NL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacggacaagtaattaaagtaaacaatggtgtactagatgtaccaaataaccca
gtcgttccttttatcgaaggtgacggaattggtcctgatatttgggctgctgcttcacgt
gtaatagatgctgcagttgaaaaagcttataatggcgaaaagaaaatcgagtggaaagaa
attcttgctggggaaaaagcttataaccaaactggcgaatggttaccagcagaaacatta
gatgcagttcgcgaatatttaattgcaattaaaggtcctttaacaactccaattggtgga
ggtattcgttctttaaacgttgctcttcgtcaagagttagatctttatgtttgtttacgt
ccagttcgttactttgatggtgtaccttcacctgtaaaacgtcctgaagatacagacatg
gtaatcttccgcgaaaactctgaagatatctatgctggtattgagtataaagaaggttct
gatgaagtgaaaaagcttattgctttcttacaaaatgaaatgggtgtaagtaaaatccgt
ttccctgaaacttctggtattggtatcaaacctgtatcacaagaaggaacagaccgacta
gttcgtgccgcaattcaatatgcaattgatgaaggacgtaagagtgttacattagtacac
aaaggtaatatcatgaagtttactgaaggggcgttcaaaaactggggttatgaagtggct
gagcgtgagtttggtgataaagtattcacttgggctcaatatgataagattgttgaagct
gaaggtaaggaagctgcgaacaaagctcaagctgacgctgaagctgaagggaaaatcatc
gtaaaagattcaattgctgatatcttcttacaacaaattttaactcgtccaaaagaattt
gatgtagttgcaacaatgaacctaaacggtgactatatctctgatgcacttgctgctcaa
gttggtggaatcggaattgctccaggagcaaacatcaactatgatactggtcatgctatt
tttgaagctacacacggaacagctccaaaatatgctggtcttgataaagtaaatccatct
tctgttcttctttcaggagaattaatgcttcgtcaccttggttggaatgaagctgctgac
cttatcatggcttctatggataaaacaattgctagcaaagtagtaacatacgattttgca
cgcctaatggaaggtgctactgaagtatcttgctctggctttgctgaagaattaatcaaa
aacctataa

DBGET integrated database retrieval system