KEGG   Bacillus krulwichiae: BkAM31D_18680Help
Entry
BkAM31D_18680     CDS       T04947                                 

Gene name
pfkA_3
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bkw  Bacillus krulwichiae
Pathway
bkw00010  Glycolysis / Gluconeogenesis
bkw00030  Pentose phosphate pathway
bkw00051  Fructose and mannose metabolism
bkw00052  Galactose metabolism
bkw00680  Methane metabolism
bkw01100  Metabolic pathways
bkw01110  Biosynthesis of secondary metabolites
bkw01120  Microbial metabolism in diverse environments
bkw01130  Biosynthesis of antibiotics
bkw01200  Carbon metabolism
bkw01230  Biosynthesis of amino acids
bkw03018  RNA degradation
Module
bkw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bkw_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bkw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BkAM31D_18680 (pfkA_3)
   00030 Pentose phosphate pathway
    BkAM31D_18680 (pfkA_3)
   00051 Fructose and mannose metabolism
    BkAM31D_18680 (pfkA_3)
   00052 Galactose metabolism
    BkAM31D_18680 (pfkA_3)
  09102 Energy metabolism
   00680 Methane metabolism
    BkAM31D_18680 (pfkA_3)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BkAM31D_18680 (pfkA_3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bkw01009]
    BkAM31D_18680 (pfkA_3)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bkw03019]
    BkAM31D_18680 (pfkA_3)
Enzymes [BR:bkw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BkAM31D_18680 (pfkA_3)
Protein phosphatases and associated proteins [BR:bkw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BkAM31D_18680 (pfkA_3)
Messenger RNA biogenesis [BR:bkw03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BkAM31D_18680 (pfkA_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ARK31703
UniProt: A0A1X9MHS2
LinkDB All DBs
Position
complement(3401267..3402226)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHDLEVYGVYYGYQGLINGDIVKMELGSVGDI
IHRGGTMLYTARCEEFKTLEGQQKAIEQLNKFGIEGLVVIGGDGSYQGALKLTEHGFPTI
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDLALWS
GLADGAETILIPEADYDMKDIIARLKRGQERGKKHSIIIVAEGIGSGFEFGDRIEEEMNL
ETRVTVLGHIQRGGSPTGFDRVLASRLGAKAVDLLLDGKAGVTVGIEKNELVYHDIKEAL
SRKHSIDLDMYKLSQQLSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggataggagttttgactagtggtggggattcacctggaatgaatgcagccatt
cgtgctgtcgttcgtaaggccatctatcatgatttagaagtgtatggagtttattatggt
tatcaaggattaattaatggggatattgttaagatggagcttggttctgttggtgatatt
attcaccgtggaggaacaatgctttatactgcgcgttgtgaagagttcaagacgttggaa
ggtcagcaaaaagctattgagcaattaaataaatttggaattgaagggcttgtcgttatt
ggtggagatggatcttaccaaggggctcttaaattaacagagcacggctttccaacaata
ggggtgccgggtaccattgataatgacattccaggtacagacttcacgattggttttgat
acggctttaaacactgtcattgatgcgattgataagattcgtgatacagccacatctcat
gagcgtacatatgtaattgaagttatgggacgtcatgctggagacttagcattatggtca
ggactagctgatggtgcagagactattttaattccagaagctgattatgatatgaaagac
attattgctcgactgaagcgcggacaagagcgtggaaagaagcacagtatcattatcgtt
gcggaagggattggtagtggttttgaatttggagatcgtattgaagaggaaatgaatctt
gaaacacgtgtaactgttttaggacatattcaacgtggtggttcacctacaggattcgac
cgcgttcttgcaagtcgccttggagcaaaagcggtggacttattgttagatggaaaagca
ggagtaacagtagggattgagaagaacgaacttgtctatcatgatattaaagaagctcta
tcaagaaagcattcaattgatcttgacatgtacaagctttctcaacaattatcgatttaa

DBGET integrated database retrieval system