KEGG   Bacillus krulwichiae: BkAM31D_20570Help
Entry
BkAM31D_20570     CDS       T04947                                 

Gene name
hisE
Definition
(GenBank) Phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
bkw  Bacillus krulwichiae
Pathway
bkw00340  Histidine metabolism
bkw01100  Metabolic pathways
bkw01110  Biosynthesis of secondary metabolites
bkw01230  Biosynthesis of amino acids
Module
bkw_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bkw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BkAM31D_20570 (hisE)
Enzymes [BR:bkw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BkAM31D_20570 (hisE)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BkAM31D_20570 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG Rad21_Rec8
Motif
Other DBs
NCBI-ProteinID: ARK32043
UniProt: A0A1X9MIE2
LinkDB All DBs
Position
complement(3734994..3735620)
Genome map
AA seq 208 aa AA seqDB search
MSIDTIQFDQNGLVPAIVQDAGSKEVLTLAYMNKESLEKSLETRETWFYSRSRQELWHKG
ATSGNTQQIIDMRYDCDADAIVVLVDPAGPACHKGEYTCFADSLLEQQPVKVNSTRFAIM
DELERTIAEREAEMPEGAYTTYLFEKGVDKILKKVGEEAGEVIIAAKNRDPEELKWEVAD
LFYHVLVLLREQKLPLDEVLKVLEERHK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgatacaattcaatttgatcaaaatggccttgtgcccgcgattgttcaagat
gcaggaagcaaggaagtattaacgcttgcttatatgaacaaagaatcattagagaaatcc
cttgaaacacgtgaaacgtggttctactcacgttcacgccaagaactttggcataagggg
gcaacatcaggaaatacgcagcaaatcatcgacatgcgctatgattgcgatgctgatgcc
attgttgttcttgttgatccagcgggacctgcatgtcataaaggagaatacacgtgtttt
gctgattcacttttggaacaacagccagtgaaagtgaattcaacacgttttgcgattatg
gacgagcttgagcgcacaattgctgagcgtgaagcagaaatgccggaaggggcttatacg
acgtatttatttgaaaaaggcgttgataagattttgaaaaaagtcggtgaagaagcgggt
gaggtcatcatcgcggcgaaaaaccgtgaccctgaggaattgaagtgggaagtagccgat
cttttctaccatgtacttgtgctcttacgtgagcagaagctaccacttgatgaagtgtta
aaagtgttagaggaaagacataaataa

DBGET integrated database retrieval system