KEGG   Bacillus krulwichiae: BkAM31D_22945Help
Entry
BkAM31D_22945     CDS       T04947                                 

Definition
(GenBank) D-arabitol-phosphate dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
bkw  Bacillus krulwichiae
Brite
KEGG Orthology (KO) [BR:bkw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BkAM31D_22945
Enzymes [BR:bkw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BkAM31D_22945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C NAD_binding_3 ADH_zinc_N_2 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ARK32490
UniProt: A0A1X9MIF5
LinkDB All DBs
Position
complement(4169283..4170371)
Genome map
AA seq 362 aa AA seqDB search
MCKSANIPTEMKAVVAYSPGDYRLETVPVPTIEAGEMLVKVEACGICAGDLKAYDGAPSF
WGDEEQPAYIKAPMIPGHEFIGHVVALGEGVEGFEVGDRVISEQIVPCWKCRFCKRGQYW
MCEKHDLYGFQNNVNGAMAEYMKFTKEAINYKVPDELPIEKAILIEPYACSMHAVQRAKI
ELGDVVVLAGAGTLGLGMIGAIKKSGAEKLIVLDLFDDRLELAKQFGADLVINPAKEDAD
KIVKDLTEGYGCDVYIEATGAQKSVEQGLKMIRKLGTFVEFSVFKEPVTVDWSIISDRKE
LDVLGSHLGPYCYEPVIKGIGNGDLPTEGVVTHQLALEDFKEGFDLVKNGRDSLKVILKP
NL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaaagtgcaaatattccaacagaaatgaaagcagttgtagcgtattcaccgggg
gattaccgtttagagacggtgccggtaccgacgattgaagcgggtgaaatgcttgtgaaa
gtagaagcttgcggaatttgtgcaggggatttaaaagcgtatgacggcgctcctagtttc
tggggagatgaagaacaaccggcttacataaaggctccgatgattccggggcatgagttt
atcggtcatgttgttgcgttaggggaaggtgtggaaggatttgaagttggggatcgagtg
atttctgagcaaatcgttccttgttggaagtgtcgtttttgtaagagaggccagtattgg
atgtgcgaaaagcatgacctttacggtttccaaaacaatgtaaatggtgcaatggctgaa
tatatgaagtttacaaaagaagcaatcaactataaagtgcctgatgaacttccaattgaa
aaggcgattttaattgagccgtatgcgtgctcgatgcatgctgtacagcgcgcgaagatt
gagcttggcgatgtagtcgtgcttgctggtgcgggaactttagggttagggatgattggg
gcaatcaagaagtcgggagcagagaagttaatcgtgcttgatttattcgatgatcgtcta
gagcttgcgaagcagtttggggcagaccttgtcatcaacccagcgaaggaagatgcggat
aagatcgttaaagatttaacggaaggttatggatgtgacgtttatatagaagcaactggt
gctcagaagtcagtcgagcaaggactgaaaatgattcgtaagcttggtacgtttgtagag
ttcagtgtctttaaagagccggtaacggttgactggagtattattagtgaccgtaaagag
cttgatgtcttaggttctcacttaggtccttactgctatgagcctgtcattaaaggaatt
ggcaatggcgacttgccgacagaaggcgttgtgacgcatcaattagcattagaagacttt
aaagaaggttttgaccttgtgaaaaatggaagagactctttgaaagttattttgaaacca
aatctataa

DBGET integrated database retrieval system