KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0399Help
Entry
BLA_0399          CDS       T00819                                 

Gene name
rpiA
Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
bla00030  Pentose phosphate pathway
bla01100  Metabolic pathways
bla01110  Biosynthesis of secondary metabolites
bla01120  Microbial metabolism in diverse environments
bla01130  Biosynthesis of antibiotics
bla01200  Carbon metabolism
bla01230  Biosynthesis of amino acids
Module
bla_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bla_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BLA_0399 (rpiA)
Enzymes [BR:bla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     BLA_0399 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-ProteinID: ACL28701
UniProt: B8DW50
LinkDB All DBs
Position
complement(495906..496607)
Genome map
AA seq 233 aa AA seqDB search
MDKAQQDAMKKEAGIEAAKLVKSGMIVGLGTGSTVRFLVDELGRRKQEEGLEFTGVTTSR
RTQEQAEGYGIKIVNIDDVDHIDLCIDGADEVDKNFNGIKGGGAALLWEKIVAINSNRIV
WIVDASKLVDVIGKFPLPVEVIPFGAMHVIERMKERGYNPTLRLDAEGKPVRTDENNYVV
DLHLERIDDPAGLNEDLINMVGVVEDGLFLDMVNEVIVGDPNGPRTLINPNKA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggataaagcacagcaggatgcaatgaagaaggaggccggcatcgaggccgcgaagctg
gtcaaaagtggcatgatcgtggggctcggcaccggttccaccgtgcgcttcctcgtcgac
gaactcggccgccgcaagcaggaggaaggtctggagttcaccggcgtcaccacttcgcgc
cgcacgcaggagcaggccgagggctacggcattaagatcgtgaacatcgacgacgtcgac
cacatcgacctgtgcatcgacggagccgacgaggttgacaagaacttcaacggcatcaag
ggcggcggcgcggccctcctgtgggagaagatcgtggcgatcaactcgaacaggatcgtc
tggatcgtcgacgcctccaagctcgtcgacgtcattggcaagttcccgctgccggtggag
gtcattccgttcggcgccatgcatgtgatcgagcgcatgaaggaacgcggctacaacccg
acgctgcgtcttgacgccgaaggcaagccggtgcgcaccgacgagaacaactacgtcgtc
gacctgcatctcgagcgcatcgacgacccggcaggtctcaacgaggatctcatcaacatg
gtgggcgtcgtcgaagacggcctgttcctcgacatggtcaacgaggtcatcgtgggcgat
ccgaacggcccgcgcacgctcatcaatccgaacaaggcgtga

DBGET integrated database retrieval system