KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0941Help
Entry
BLA_0941          CDS       T00819                                 

Gene name
pknA
Definition
(GenBank) probable serine-threonine protein kinase PknA
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Brite
KEGG Orthology (KO) [BR:bla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bla01001]
    BLA_0941 (pknA)
Enzymes [BR:bla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BLA_0941 (pknA)
Protein kinases [BR:bla01001]
 Serine/threonine kinases: Other
  Bacterial family
   BLA_0941 (pknA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like Haspin_kinase Kdo Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: ACL29233
UniProt: B8DTA4
LinkDB All DBs
Position
complement(1202073..1204298)
Genome map
AA seq 741 aa AA seqDB search
MVDTTAHGTDHYNLIDGRYRIVRKIADGGMATVYQTVDERLGRNVAVKIMHMQLAQGPHR
EQFIERFRREAKSAAAIANPHVVQVYDTGETNGSYYLVMEYVHGVNLRSQMQTHTTFSVR
DTLRIVGETLNGLAAAHEIGVVHRDIKPENILINDRGHVEITDFGLAKAASQATLSSTGM
LLGTAAYLAPEMIENNQATPQGDCYSVGIMAWELLAGRVPFQSDNPVTMVFRHVNENIPS
IGTVCYGIDPRVSAFISYLTARDVNARPKSAQKALDRLRELMPTLSRQALDYRFRPQEPP
INSTRVFPMGANEQDSDRPSVSSKSDSPEESTPPPTSAAALFTALASPDLTEEEAEQART
VALATPPDDSSTPGSGVPASGGTTVPPYGGSTGSYGRNSGRPGEPGAPLPSNAQTQVQPR
KKHRTAMIVSIIAAILALGAGGGFALWYFVGPGSYWTLPKPEGLSCAENAPCKITGVKWD
AYERLLKVSQIPYKSTQQYSDTVPAGEIISTDPQFVDAHVSKRASGEVHVTVSQGVQQAT
VPEGIMSSSSPLDDLRKAGFTNITHSEDNDEYSESVPEGEVIDITPSAGTTQNHNDDVVV
TLSKGPMPVAMPNVVGMTRGQAQKSFDDAKLKATYTEEYSDTIPRDQVISVDPEAGTQLH
WGDAVTVTVSKGPEMVTVPDITGKKTEEARKILEDLGFEVKVSSPLGDLLHTVRFQDPKG
GQQVRLRGEDGKKTVITLTVI
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggtggataccacggcacacggcacggaccactacaatctcattgacggccgctaccgc
attgtgcgcaagatcgcggatggcggcatggccacggtgtaccagaccgtcgacgaaagg
ctcgggcgcaatgtggcggtcaaaatcatgcacatgcagctggcccagggcccccaccgc
gagcagttcatcgagcgcttccgacgggaggccaaatccgcggcagcaatagccaatccg
catgtggtgcaggtgtacgacaccggtgagacgaatggctcgtactatctggtcatggag
tatgtgcacggcgtgaatctgcgtagtcagatgcagacgcacaccacgttctcggtgcgc
gacaccctgcgcatcgtcggcgagacattgaacggacttgccgccgcccacgagatcggc
gtcgtacaccgcgacatcaagccggagaacattctgatcaacgaccgcggtcatgtggag
atcaccgatttcggcctagccaaggccgcctcgcaggccacgctctcctccaccgggatg
ctgcttggcacagcggcctatctcgccccggagatgatcgaaaacaaccaggccactcct
cagggcgactgctattccgtgggcatcatggcatgggagctgctggcggggagggtgccg
ttccagtcagacaatccggtgacgatggtgttcaggcacgtcaacgagaacatcccctcc
ataggaacggtgtgctacggcatcgacccccgggtttcggccttcatctcgtacctgacc
gcacgtgacgtcaatgcccgtccgaaaagcgcacagaaggcgttggatcgcctccgtgag
ctcatgcccacgctgagccgccaggcattggactatcgcttccgcccccaggaaccaccc
atcaacagcactcgggtgttcccaatgggtgcgaatgagcaggattccgaccgtccctcc
gtttcgagcaaatcggattcgccggaagaatccactccaccacctacctctgccgccgcg
cttttcactgcattggcctcccccgatctcactgaagaggaggcggaacaggcaagaacg
gtagctctcgccacaccgccggacgactcctcgacgccaggctctggggttccggcctcc
ggtggaaccaccgttccaccatatggaggctctaccggaagttatgggcgtaattccggc
cgtcccggcgagccaggtgcgccattgcccagcaatgcccagacgcaagtgcagcctcgc
aagaagcatagaacggcgatgatcgtttcgatcatcgccgccatactcgcattgggtgcc
ggtggcggattcgcattgtggtacttcgtggggcctggcagctactggacactgcccaaa
cccgaggggctcagttgtgccgaaaatgcgccatgcaagatcacaggtgtgaaatgggat
gcctatgagcgtctgctcaaagtctcgcagattccgtacaaaagcacacagcagtatagc
gacacagtgcctgccggcgagatcatctccaccgacccgcaatttgtggatgcccatgtg
agcaagcgggccagcggcgaggtgcatgtgacggtgtcgcaaggtgtgcagcaggccacc
gttcccgaaggcatcatgagcagctcgtcccctctggacgacctgcggaaggcgggcttc
accaacatcacgcacagcgaagacaacgacgagtattccgaaagcgttccggaaggcgag
gtcatcgacatcacgcccagcgccggcaccacacagaaccataacgacgacgtcgtggtg
acgctctccaaagggcccatgccggtggcaatgccgaatgtggtgggcatgacgcgcggt
caggcgcagaagtcgtttgatgacgccaagctcaaggcgacctacaccgaagagtacagc
gatacgattccacgggaccaggtgatttcagtggatcccgaggcgggaacccaattgcac
tggggcgatgcggtcacagtcaccgtctcgaagggccctgaaatggtgaccgttcccgac
atcacgggcaagaagacggaggaggccaggaagatccttgaagacctcggctttgaggtg
aaggtctcatcaccgttgggcgacctcctgcacaccgtgcgattccaagatcccaaaggc
ggccagcaggtgcgtctgcgtggcgaagacggcaagaaaacggtgatcacactcacggtg
atctga

DBGET integrated database retrieval system