KEGG   Blastochloris sp. GI: BLTE_02090Help
Entry
BLTE_02090        CDS       T05837                                 

Gene name
bchL
Definition
(GenBank) Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
blag  Blastochloris sp. GI
Pathway
blag00860  Porphyrin and chlorophyll metabolism
blag01100  Metabolic pathways
blag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BLTE_02090 (bchL)
Enzymes [BR:blag01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     BLTE_02090 (bchL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB MipZ AAA_24 AAA_26 NB-ARC SRP54 CBP_BcsQ
Motif
Other DBs
NCBI-ProteinID: BBF91524
UniProt: A0A348FW41
LinkDB All DBs
Position
260297..261196
Genome map
AA seq 299 aa AA seqDB search
MKPITLLDSGSQRPDGEGSVQVHMDQRLNLGTAKIFSIYGKGGIGKSTTSSNLSVAFSKL
GKRVLQIGCDPKHDSTFTLTKRLVPTVIDILEGVDYHSEELRPEDYVFEGYNGVMCVEAG
GPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHSERALIVAA
NDFDSIFAMNRIVAAIQAKSKNYPVRLGGVIANRSAQTDQIDKFNEAVGLKTRAHIPALD
VIRLSRLKKATLFEMEPTPDVLAVQKEYLQLAETLYAGVDPLVVKPLKDREIFDLLGFD
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcccattaccctactcgacagcggttcccagcggccggacggcgagggcagcgtg
caggtccatatggaccagcggctcaacctcggcaccgcgaagatcttctcgatctacggc
aagggcggcatcggcaagtcgaccacctcctccaacctgtcggtggcgttctccaagctc
ggcaagcgggtgctgcagatcggctgcgaccccaagcacgattcgaccttcacgctcacc
aagcggctggtgccgacggtgatcgatatcctcgagggcgtggactaccactccgaggaa
ctgcggcccgaagactatgtgttcgagggctataacggcgtgatgtgcgtggaggcgggc
ggcccgccggccggcaccggctgcggcggatacgttgtcggccagacggtgaagctcctt
aaggagcatcacctactcgaagataccgatgtggtgatcttcgacgtgctcggcgacgtg
gtgtgcggcggcttcgcggccccgctccagcactccgagcgggcgctgatcgtcgccgcc
aacgacttcgattcgatcttcgccatgaaccgaatcgtcgcggcgattcaggcgaaatcg
aagaattatccggtgcggctgggcggcgtgatcgccaaccgcagcgcccagaccgaccag
atcgacaaattcaacgaagctgtgggactcaagacccgcgcccacattccggctctcgac
gtgatccgcctgagccgactaaagaaggcaacattgttcgagatggagccgacgccggat
gtgctcgccgtgcagaaggagtatcttcagctcgccgagactctctatgccggggtcgat
ccgctggtggtgaagccgctcaaggaccgtgaaattttcgaccttttggggttcgattga

DBGET integrated database retrieval system