KEGG   Blastochloris sp. GI: BLTE_09430Help
Entry
BLTE_09430        CDS       T05837                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
blag  Blastochloris sp. GI
Pathway
blag00061  Fatty acid biosynthesis
blag00780  Biotin metabolism
blag01100  Metabolic pathways
blag01212  Fatty acid metabolism
Module
blag_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:blag00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BLTE_09430 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BLTE_09430 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:blag01004]
    BLTE_09430 (fabZ)
Enzymes [BR:blag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BLTE_09430 (fabZ)
Lipid biosynthesis proteins [BR:blag01004]
 Fatty acid synthase
  Component type
   BLTE_09430 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: BBF92258
UniProt: A0A348FY75
LinkDB All DBs
Position
1041663..1042121
Genome map
AA seq 152 aa AA seqDB search
MTAEPGKVLEALDIQRVLALLPHRYPFLMVDRVEKIDSDNSAVGIKAVTINEPHFQGHFP
GRPVMPGVLLIEGMAQTAGAICILSRGTNSPSVVYFLTIDNCKFRRPVVPGDVVEFHMTK
TAKRRNMWWYHGEAKVNGEIVAEADLGAMLGE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagaaccgggcaaggtgctcgaggcgctcgacatccagcgcgtgctggcgctg
ctgccgcaccgctatccgttcctgatggtggaccgggtcgagaagatcgacagcgacaat
tcggccgtcggcatcaaggcggtcaccatcaacgagccgcacttccagggccatttcccc
ggccggccggtgatgccgggcgtgctgctgatcgagggtatggcccagaccgcgggcgcc
atctgcatcctgtcgcgcggcaccaacagcccgagcgtggtctatttcctcaccatcgac
aactgcaagttccgccggccggtggtgccgggcgacgtcgtcgagttccacatgaccaag
accgccaagcggcggaacatgtggtggtaccacggcgaagccaaggtcaatggcgagatc
gtcgccgaggccgacctcggcgccatgctgggcgagtga

DBGET integrated database retrieval system